Comparing Pf6N2E2_5939 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5939 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
32% identity, 92% coverage: 51:760/771 of query aligns to 9:719/732 of 8gy3C
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
23% identity, 59% coverage: 206:659/771 of query aligns to 7:464/748 of 5y6qC
Sites not aligning to the query:
4uhxA Human aldehyde oxidase in complex with phthalazine and thioridazine (see paper)
24% identity, 48% coverage: 214:583/771 of query aligns to 552:923/1290 of 4uhxA
Sites not aligning to the query:
8emtA Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
25% identity, 48% coverage: 214:583/771 of query aligns to 511:887/1254 of 8emtA
Sites not aligning to the query:
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
25% identity, 48% coverage: 214:583/771 of query aligns to 495:854/1221 of 8emtB
Sites not aligning to the query:
3sr6C Crystal structure of reduced bovine xanthine oxidase in complex with arsenite (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 17:325/745 of 3sr6C
Sites not aligning to the query:
3nvyC Crystal structure of bovine xanthine oxidase in complex with quercetin (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 17:325/756 of 3nvyC
Sites not aligning to the query:
3nvwC Crystal structure of bovine xanthine oxidase in complex with guanine (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 17:325/756 of 3nvwC
Sites not aligning to the query:
3eub4 Crystal structure of desulfo-xanthine oxidase with xanthine (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 17:325/756 of 3eub4
Sites not aligning to the query:
3nvzC Crystal structure of bovine xanthine oxidase in complex with indole-3- aldehyde (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 17:325/755 of 3nvzC
Sites not aligning to the query:
3nvvC Crystal structure of bovine xanthine oxidase in complex with arsenite (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 17:325/755 of 3nvvC
Sites not aligning to the query:
3ns1C Crystal structure of bovine xanthine oxidase in complex with 6- mercaptopurine (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 17:325/755 of 3ns1C
Sites not aligning to the query:
3etrC Crystal structure of xanthine oxidase in complex with lumazine (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 17:325/755 of 3etrC
Sites not aligning to the query:
3b9jC Structure of xanthine oxidase with 2-hydroxy-6-methylpurine (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 17:325/758 of 3b9jC
Sites not aligning to the query:
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
27% identity, 36% coverage: 182:456/771 of query aligns to 2:301/797 of 1ffvB
Sites not aligning to the query:
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
27% identity, 36% coverage: 182:456/771 of query aligns to 2:301/797 of 1ffuB
Sites not aligning to the query:
3ax7A Bovine xanthine oxidase, protease cleaved form (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 486:794/1225 of 3ax7A
Sites not aligning to the query:
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 554:862/1299 of 1vdvA
Sites not aligning to the query:
1fo4A Crystal structure of xanthine dehydrogenase isolated from bovine milk (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 554:862/1299 of 1fo4A
Sites not aligning to the query:
1v97A Crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form (see paper)
22% identity, 39% coverage: 221:517/771 of query aligns to 553:861/1298 of 1v97A
Sites not aligning to the query:
>Pf6N2E2_5939 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5939
MSRLPDDFVLSNLSRRGFLKGASATGVLVLAATWGLPDAFAEEKKFGAEGMPHGAVDDPK
VYVSIATDGSVTVICNRSEMGQGVRTSLSMVVADELEADWARVKVQQAPADEARFGNQDT
DGSRSMRHWYEPMRRCGAAARTMLELAAAAQWKVPVGECHAQLHKVLHQPSGRELGYGEL
AAAASALAVPSRGSLRLKQPSEFRYIGKEASRAIDGADIVNGRAVFGADVHFDGMLYAVI
ARPPVYGGKVKSVDSSAALKVPGVVKVVQIEGRPLPSEFQPLGGVAVVAKNTWAAIKGRE
ALKIQWDDGPNAGYDSIAYRKELEAAALKPGKVVRSSGDLDDALAKADSTLEASYYLPHL
SQSPMEPMVAVARFKDGQCEAWAPSQAPQVTRERVAERLGIPFEKVTVNITLLGGGFGRK
SKPDFVVEAAVLAKEFPGQAIRVQWTREDDIHHSYFHTVSAEYLKAGLNQDGMPSGWLHR
TVAPSITALFAPGMTHEAPFEIGMGVTNMAYAIPNLRLENPEAVAHARVGWYRSVSNIPH
GFAIQSFIDELAHKAGQDPLKYQVKLLGPDRKIDPRSLSEEWNYGESPERYPIDTARIRT
VLETAAKAAGWGRELPKGRGLGLAVHYSFVTYVAAVIEVEVKDDGTVIVHKADIAVDCGP
QINPERIRSQFEGACVMGLGNAMVGEISFKDGKVQQDNFHMYEVARMSLAPKEVAVHLVT
PPGEVPLGGVGEPGVPPIAPALCNAIFAATGKRIRSLPVRYQLQGWQQAKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory