Comparing Pf6N2E2_5968 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5968 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5abpA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
61% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 5abpA
1abfA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
61% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 1abfA
1abeA Novel stereospecificity of the l-arabinose-binding protein (see paper)
61% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 1abeA
4kzkA The structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
46% identity, 90% coverage: 32:332/334 of query aligns to 1:301/301 of 4kzkA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
24% identity, 87% coverage: 34:324/334 of query aligns to 3:274/274 of 2ioyA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
28% identity, 69% coverage: 34:265/334 of query aligns to 5:218/270 of 4zjpA
Sites not aligning to the query:
>Pf6N2E2_5968 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_5968
MKHRRGIRSLCRAALAVTAVSLSSHLLAADAVKIGFLVKQAEEPWFQTEWAFAEKAAKDK
GFQLIKIAVPDGEKTLSAIDSLAANGAKGFVICPPDVSLGPAIVAKAKLNDMKVIAVDDR
FVGSDGKFMEDVPYLGMAAFEVGQKQGGAMAAEAKKRGWDWKDTYAVINTYNELDTGKKR
TDGSVDALKKAGMPADHILYSALKTLDVPGSMDSTNSALVKLPSAAKNLIIGGMNDNTVL
GGVRATEAAGFKAANVIGIGINGTDAIGELKKPDSGFFGSMLPSPHIEGYKTAEMMYEWI
TTGKEPPKYTAMDEVTLITRENFKQELEKIGLWN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory