SitesBLAST
Comparing Pf6N2E2_599 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_599 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7mh7A Crystal structure of NAD kinase from pseudomonas aeruginosa pao1
88% identity, 98% coverage: 2:291/296 of query aligns to 1:290/290 of 7mh7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D71 (= D72), G72 (= G73), R93 (= R94), F98 (= F99), N145 (= N146), D146 (= D147), T186 (= T187), A187 (= A188), Y188 (= Y189), S191 (= S192), D244 (= D245), K283 (= K284)
P0A7B3 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Escherichia coli (strain K12) (see paper)
47% identity, 98% coverage: 3:291/296 of query aligns to 4:291/292 of P0A7B3
- R175 (≠ K174) mutation to E: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to G: Exhibits NADH kinase activity in addition to NAD kinase activity. Reduces the Vmax of the NAD kinase activity.; mutation to H: Exhibits NADH kinase activity in addition to NAD kinase activity.; mutation to I: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to K: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to Q: Exhibits NADH kinase activity in addition to NAD kinase activity.; mutation to T: Exhibits NADH kinase activity in addition to NAD kinase activity.
P9WHV7 NAD kinase; ATP-dependent NAD kinase; Poly(P)-dependent NAD kinase; PPNK; EC 2.7.1.23 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
38% identity, 68% coverage: 63:262/296 of query aligns to 76:274/307 of P9WHV7
- D85 (= D72) mutation to A: Abolishes catalytic activity.
- N159 (= N146) mutation to A: Abolishes catalytic activity.
- NE 159:160 (≠ ND 146:147) binding
- E160 (≠ D147) mutation to A: Abolishes catalytic activity.
- G190 (= G177) mutation to A: Abolishes catalytic activity.
- L192 (≠ I179) mutation to A: Abolishes catalytic activity.
- T195 (= T182) mutation to A: It promotes stronger allosteric interactions.
- P196 (= P183) mutation to A: Abolishes catalytic activity.
- T197 (= T184) binding ; mutation to A: Abolishes catalytic activity.
- G198 (= G185) mutation to A: Abolishes catalytic activity.
- S199 (= S186) mutation to A: Lower catalytic efficiency. A perturbation of the allosteric interactions is observed when NAD is used as substrate.
- T200 (= T187) mutation to A: Abolishes catalytic activity.
- TAYAFS 200:205 (≠ TAYALS 187:192) binding
- Y202 (= Y189) mutation to A: Abolishes catalytic activity.
- G207 (= G194) mutation to A: Abolishes catalytic activity.
- G208 (= G195) mutation to A: Possesses 30% of the activity compared to the wild-type enzyme. While mutant affects the catalytic efficiency, it does not alter the binding affinity for ATP and poly(P). It causes a decrease in the affinity for NAD and alters the allosteric interactions mediated by the dinucleotide, both in the presence of poly(P) and ATP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1y3iA Crystal structure of mycobacterium tuberculosis NAD kinase-NAD complex (see paper)
37% identity, 67% coverage: 70:268/296 of query aligns to 12:209/231 of 1y3iA
- binding nicotinamide-adenine-dinucleotide: D14 (= D72), G15 (= G73), R38 (≠ S96), F41 (= F99), L42 (= L100), N88 (= N146), E89 (≠ D147), T129 (= T187), A130 (= A188), Y131 (= Y189), S134 (= S192)
O13863 Uncharacterized kinase C1B1.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 90% coverage: 28:292/296 of query aligns to 235:516/537 of O13863
Sites not aligning to the query:
- 72 modified: Phosphoserine
3afoA Crystal structure of yeast nadh kinase complexed with nadh
30% identity, 81% coverage: 49:287/296 of query aligns to 97:342/360 of 3afoA
- binding 1,4-dihydronicotinamide adenine dinucleotide: D120 (= D72), G121 (= G73), L124 (= L76), F148 (= F99), N196 (= N146), D197 (= D147), T237 (= T187), A238 (= A188), Y239 (= Y189), S242 (= S192), D300 (= D245), G301 (= G246)
1z0zA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with NAD (see paper)
32% identity, 64% coverage: 61:248/296 of query aligns to 38:212/249 of 1z0zA
- active site: E96 (≠ L127), C105 (≠ A136)
- binding nicotinamide-adenine-dinucleotide: N115 (= N146), E116 (≠ D147), M127 (= M158), R143 (≠ K174), D145 (= D176), T156 (= T187), Y158 (= Y189), S161 (= S192), F182 (≠ H213), D209 (= D245), G210 (= G246)
1z0sA Crystal structure of an NAD kinase from archaeoglobus fulgidus in complex with atp (see paper)
32% identity, 64% coverage: 61:248/296 of query aligns to 38:212/249 of 1z0sA
- active site: E96 (≠ L127), C105 (≠ A136)
- binding adenosine-5'-triphosphate: R54 (≠ G77), N115 (= N146), E116 (≠ D147), A125 (≠ T156), K126 (≠ R157), M127 (= M158), D145 (= D176), G157 (≠ A188), Y158 (= Y189), S161 (= S192), A180 (≠ Y211), F182 (≠ H213), D209 (= D245)
- binding pyrophosphate 2-: G48 (= G71), G50 (= G73), T51 (≠ S74), R54 (≠ G77), R72 (≠ S96)
Sites not aligning to the query:
1suwA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with its substrate and product: insights into the catalysis of NAD kinase (see paper)
32% identity, 64% coverage: 61:248/296 of query aligns to 38:212/249 of 1suwA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G48 (= G71), D49 (= D72), G50 (= G73), N115 (= N146), E116 (≠ D147), A125 (≠ T156), M127 (= M158), R143 (≠ K174), D145 (= D176), T156 (= T187), Y158 (= Y189), S161 (= S192), F182 (≠ H213), D209 (= D245), G210 (= G246)
O30297 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
32% identity, 64% coverage: 61:248/296 of query aligns to 38:212/249 of O30297
Q9P7K3 Uncharacterized kinase C24B10.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 77% coverage: 62:290/296 of query aligns to 174:409/449 of Q9P7K3
Sites not aligning to the query:
- 420 modified: Phosphoserine
6rc0A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
31% identity, 59% coverage: 64:238/296 of query aligns to 37:216/261 of 6rc0A
4dy6A Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with 2'-phosphate bis(adenosine)-5'-diphosphate (see paper)
30% identity, 59% coverage: 64:238/296 of query aligns to 37:214/258 of 4dy6A
- binding [(2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl[(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl dihydrogen diphosphate: D45 (= D72), G46 (= G73), H71 (≠ S96), F74 (= F99), N117 (= N146), E118 (≠ D147), T156 (= T187), A157 (= A188), Y158 (= Y189), S161 (= S192)
6rgeA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with an inhibitor
30% identity, 59% coverage: 64:238/296 of query aligns to 37:214/259 of 6rgeA
- binding [(2~{R},3~{R},4~{R},5~{R})-2-[8-[3-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy]prop-1-ynyl]-6-azanyl-purin-9-yl]-5-(hydroxymethyl)-4-oxidanyl-oxolan-3-yl] dihydrogen phosphate: G44 (= G71), D45 (= D72), G46 (= G73), L49 (= L76), H71 (≠ S96), F74 (= F99), N117 (= N146), E118 (≠ D147), T156 (= T187), A157 (= A188), Y158 (= Y189), S161 (= S192)
6rgcA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an inhibitor (see paper)
30% identity, 59% coverage: 64:238/296 of query aligns to 37:214/259 of 6rgcA
- binding (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[[3-[6-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl]purin-8-yl]prop-2-ynyl-methyl-amino]methyl]oxolane-3,4-diol: D45 (= D72), G46 (= G73), L72 (= L97), F74 (= F99), N117 (= N146), E118 (≠ D147), T156 (= T187), A157 (= A188), Y158 (= Y189), S161 (= S192)
6rgaA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an inhibitor (see paper)
30% identity, 59% coverage: 64:238/296 of query aligns to 37:214/259 of 6rgaA
- binding (2~{R},3~{S},4~{R},5~{R})-2-(aminomethyl)-5-[8-[3-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy]prop-1-ynyl]-6-azanyl-purin-9-yl]oxolane-3,4-diol: D45 (= D72), L49 (= L76), F74 (= F99), N117 (= N146), E118 (≠ D147), T156 (= T187), A157 (= A188), Y158 (= Y189), S161 (= S192)
6rg8A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an inhibitor (see paper)
31% identity, 59% coverage: 64:238/296 of query aligns to 37:216/260 of 6rg8A
- binding (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[[4-(6-azanyl-9~{H}-purin-8-yl)but-3-ynylamino]methyl]oxolane-3,4-diol: D45 (= D72), G46 (= G73), F74 (= F99), Y75 (≠ L100), N119 (= N146), E120 (≠ D147), T158 (= T187), A159 (= A188), Y160 (= Y189), S163 (= S192)
Sites not aligning to the query:
6rbyA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
31% identity, 59% coverage: 64:238/296 of query aligns to 37:216/260 of 6rbyA
8a9vA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
31% identity, 59% coverage: 64:238/296 of query aligns to 37:216/261 of 8a9vA
- binding ~{N}-[[(2~{R},3~{S},4~{R},5~{R})-5-[8-[3-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy]prop-1-ynyl]-6-azanyl-purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-2-azanyl-ethanesulfonamide: D45 (= D72), L49 (= L76), L72 (= L97), F74 (= F99), Y75 (≠ L100), N119 (= N146), E120 (≠ D147), T158 (= T187), A159 (= A188), Y160 (= Y189), S163 (= S192)
Sites not aligning to the query:
7zzjA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
31% identity, 59% coverage: 64:238/296 of query aligns to 37:216/261 of 7zzjA
- binding (1~{R},23~{R},24~{S},25~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-24,25-bis(oxidanyl)-26-oxa-2,4,6,9,14,17,21-heptazatetracyclo[21.2.1.0^{2,10}.0^{3,8}]hexacosa-3(8),4,6,9-tetraen-11-yne-16,20-dione: D45 (= D72), G46 (= G73), L72 (= L97), F74 (= F99), Y75 (≠ L100), N119 (= N146), E120 (≠ D147), T158 (= T187), A159 (= A188), Y160 (= Y189), S163 (= S192)
Sites not aligning to the query:
- binding (1~{R},23~{R},24~{S},25~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-24,25-bis(oxidanyl)-26-oxa-2,4,6,9,14,17,21-heptazatetracyclo[21.2.1.0^{2,10}.0^{3,8}]hexacosa-3(8),4,6,9-tetraen-11-yne-16,20-dione: 220
Query Sequence
>Pf6N2E2_599 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_599
MEQFRNIGIIGRLGSSQVLDTVRRLKRFLLERHLHVILEDTIAEVLPGHGLQTSSRKMLG
EVCDMVIVVGGDGSLLGAARALARHNIPVLGINRGSLGFLTDIRPDELETKVAEVLDGHY
LVENRFLLQAEVRRHAEAIGQGDALNDVVLHPGKSTRMIEFELYIDGQFVCSQKADGLIV
ATPTGSTAYALSAGGPIMHPKLDAIVIVPMYPHTLSGRPIVVDGNSELKIVVSKDMQIYP
QVSCDGQNHFTCAPGDTITVSKKAQKLRLIHPLDHNYYEVCRTKLGWGSRLGGGGD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory