SitesBLAST
Comparing Pf6N2E2_6049 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6049 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ocqA Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
29% identity, 95% coverage: 10:229/231 of query aligns to 8:234/686 of 7ocqA
Sites not aligning to the query:
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-4~{H}-pyridin-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-3,4,5-tris(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: 252, 253, 254, 279, 280, 335, 369, 370
7ocnA Crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
29% identity, 95% coverage: 10:229/231 of query aligns to 8:234/690 of 7ocnA
7ocpA NADPH bound to the dehydrogenase domain of the bifunctional mannitol- 1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
29% identity, 95% coverage: 10:229/231 of query aligns to 8:234/688 of 7ocpA
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 250, 251, 253, 254, 279, 280, 334, 335, 336, 339, 369, 370
7ocrB NADPH and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
29% identity, 95% coverage: 10:229/231 of query aligns to 8:228/675 of 7ocrB
Sites not aligning to the query:
- binding fructose -6-phosphate: 362, 403, 508, 513, 516, 587, 590, 594, 595, 601
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 244, 246, 247, 248, 273, 274, 329, 330, 333, 361, 362, 406, 587, 590
7ocqB Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 95% coverage: 10:229/231 of query aligns to 8:229/679 of 7ocqB
Sites not aligning to the query:
- binding 1,4-dihydronicotinamide adenine dinucleotide: 245, 246, 247, 248, 249, 274, 275, 329, 330, 334, 363, 403, 405, 407, 591, 594
Q8VZ10 Protein SUPPRESSOR OF QUENCHING 1, chloroplastic; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 82% coverage: 7:195/231 of query aligns to 70:260/1055 of Q8VZ10
- D80 (= D17) mutation to N: Complete rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
Sites not aligning to the query:
- 431:434 CINC→SINS: No rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
- 859 E→K: In soq1-2; high light intensity-dependent and irreversible nonphotochemical quenching (NPQ) due to a decrease in chlorophyll excited-state lifetime.
P71447 Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see 3 papers)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/221 of P71447
- D8 (= D17) modified: 4-aspartylphosphate; mutation to A: Inactive.; mutation to E: Inactive.
- D10 (= D19) mutation to A: Inactive.; mutation to E: Inactive.; mutation to N: Inactive.; mutation to S: Inactive.
- T16 (= T25) mutation to P: 500-fold reduction in the rate constant for Asp-8 phosphorylation by beta-G1,6bisP. 6,700-fold reduction in the apparent rate constant for cycling of the phosphorylated enzyme to convert beta-G1P to G6P. 13-fold increase in the estimated rate constant for phosphoryl transfer from the phospho-Asp8 to water.
- H20 (≠ Y29) mutation to A: Impairs Asp-8 phosphorylation by beta-G1,6bisP and phosphoryl transfer from the phospho-Asp8 to the substrate beta-G1P.; mutation to N: 300-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.; mutation to Q: 8-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- K45 (≠ I53) mutation to A: 20'000-fold decrease in kcat/KM.
- G46 (= G54) mutation to A: 1'000'000-fold decrease in kcat/KM.; mutation to P: 100'000-fold decrease in kcat/KM.; mutation to V: 10'000-fold decrease in kcat/KM.
- R49 (≠ A57) mutation to K: 1'000'000-fold decrease in kcat/KM.
- S52 (≠ L60) mutation to A: Wild-type activity.
- K76 (≠ R88) mutation to A: 100-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- D170 (= D177) mutation to A: Impaired, but active with an increase in the affinity for G1P.
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 6h91A
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 4c4rA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
- binding trifluoromagnesate: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
- binding (1R)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: D10 (= D19), H20 (≠ Y29), W24 (≠ T33), L44 (≠ I52), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S52 (≠ L60), S116 (= S118), K117 (≠ S119)
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 3zi4A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
- binding Scandium Tetrafluoride: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
2wf8A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 2wf8A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding beryllium trifluoride ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), A115 (≠ S117), S116 (= S118), K117 (≠ S119)
- binding 1-O-phosphono-alpha-D-glucopyranose: D10 (= D19), H20 (≠ Y29), W24 (≠ T33), L44 (≠ I52), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S52 (≠ L60), A115 (≠ S117), S116 (= S118), K117 (≠ S119)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
2wf7A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 2wf7A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding tetrafluoroaluminate ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), K145 (= K152)
- binding 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose: D10 (= D19), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119), N118 (≠ S120)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
2wf6A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and aluminium tetrafluoride (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 2wf6A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding tetrafluoroaluminate ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), K145 (= K152)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
2wf5A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and trifluoromagnesate (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/218 of 2wf5A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), A115 (≠ S117), S116 (= S118)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
- binding trifluoromagnesate: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/224 of 5olwA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding calcium ion: D8 (= D17), D10 (= D19), P89 (vs. gap), V92 (vs. gap), E124 (≠ K126), N127 (≠ D132), E169 (= E176), D170 (= D177), S171 (= S178)
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/221 of 2wf9A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding beryllium trifluoride ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119), N118 (≠ S120)
- binding 6-O-phosphono-alpha-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), A115 (≠ S117), S116 (= S118), K117 (≠ S119), N118 (≠ S120)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/221 of 1o03A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: D8 (= D17), L9 (≠ M18), D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S114 (≠ T116), A115 (≠ S117), S116 (= S118), K117 (≠ S119), K145 (= K152)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
1lvhA The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/221 of 1lvhA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
6qzgA Beta-glucose 1,6-bisphosphonate bound to wild type beta- phosphoglucomutse in an open conformation.
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/219 of 6qzgA
- binding 3,7-anhydro-1,2,8-trideoxy-1,8-diphosphono-D-glycero-D-gulo-octitol: D8 (= D17), L9 (≠ M18), D10 (= D19), H20 (≠ Y29), G46 (= G54), S114 (≠ T116), A115 (≠ S117), S116 (= S118), K117 (≠ S119), K145 (= K152)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
1z4nA Structure of beta-phosphoglucomutase with inhibitor bound alpha- galactose 1-phosphate cocrystallized with fluoride (see paper)
29% identity, 80% coverage: 12:195/231 of query aligns to 3:188/219 of 1z4nA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 1-O-phosphono-alpha-D-galactopyranose: H20 (≠ Y29), W24 (≠ T33), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119), N118 (≠ S120)
- binding magnesium ion: D8 (= D17), D10 (= D19), E169 (= E176), D170 (= D177)
Query Sequence
>Pf6N2E2_6049 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6049
MNAPLKEFGPIKAVIFDMDGLLLDTEGIYTEVTSIIAERYGRTFDWSVKQNIIGRGATDL
ANYVVQALELPITPEEFLVIREPLMRERFPHALGMPGAEELVRHLKAHNVPIAVGTSSSS
PTFALKTTLHRDWFALFDFIVTADDPEVGAAKPAPDIFLTAARRLGVDPRDCLVFEDSPF
GVTAAKAAGMTAIAIPDSAMADEKYAHADGIIRSLKMFQPSLCGLPELEWA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory