Comparing Pf6N2E2_6062 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6062 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
87% identity, 97% coverage: 11:375/375 of query aligns to 1:365/365 of 6s87D
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
44% identity, 97% coverage: 11:375/375 of query aligns to 6:371/372 of P39120
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
38% identity, 97% coverage: 11:375/375 of query aligns to 4:370/371 of 1aj8A
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
41% identity, 96% coverage: 11:371/375 of query aligns to 9:379/379 of O34002
Sites not aligning to the query:
1a59A Cold-active citrate synthase (see paper)
41% identity, 96% coverage: 11:371/375 of query aligns to 7:377/377 of 1a59A
I6Y9Q3 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
42% identity, 95% coverage: 11:367/375 of query aligns to 31:387/393 of I6Y9Q3
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
37% identity, 97% coverage: 11:375/375 of query aligns to 4:371/371 of 1ixeA
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
37% identity, 97% coverage: 11:375/375 of query aligns to 4:374/374 of 1iomA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
35% identity, 97% coverage: 11:375/375 of query aligns to 6:370/372 of 6abyA
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
35% identity, 97% coverage: 11:375/375 of query aligns to 6:370/370 of 6abxA
2c6xA Structure of bacillus subtilis citrate synthase
37% identity, 94% coverage: 11:363/375 of query aligns to 4:357/363 of 2c6xA
P39119 Citrate synthase 1; Citrate synthase I; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
38% identity, 94% coverage: 11:363/375 of query aligns to 5:358/366 of P39119
8bp7E Citrate-bound hexamer of synechococcus elongatus citrate synthase (see paper)
36% identity, 97% coverage: 11:375/375 of query aligns to 8:377/379 of 8bp7E
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
34% identity, 95% coverage: 20:375/375 of query aligns to 8:369/369 of 6abwA
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 97% coverage: 11:375/375 of query aligns to 48:431/431 of P9WPD5
2h12B Structure of acetobacter aceti citrate synthase complexed with oxaloacetate and carboxymethyldethia coenzyme a (cmx) (see paper)
35% identity, 92% coverage: 32:375/375 of query aligns to 64:426/426 of 2h12B
P0ABH7 Citrate synthase; EC 2.3.3.16 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 96% coverage: 11:369/375 of query aligns to 46:421/427 of P0ABH7
1owbA Three dimensional structure analysis of the variant r109l nadh complex of type ii citrate synthase from e. Coli (see paper)
34% identity, 96% coverage: 11:369/375 of query aligns to 45:420/426 of 1owbA
4jagA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with oxaloacetate (see paper)
34% identity, 96% coverage: 11:369/375 of query aligns to 45:420/426 of 4jagA
4jaeA Structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. Coli complexed with s- carboxymethyl-coa (see paper)
34% identity, 96% coverage: 11:369/375 of query aligns to 45:420/426 of 4jaeA
>Pf6N2E2_6062 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_6062
MAEAKVLSGAGLRGQVAGQTALSTVGQSGAGLTYRGYDVRDLAADAQFEEVAYLLLYGEL
PTQAQLDAYTGKLRQLRDLPQALKEVLERIPADAHPMDVMRTGCSFLGNLEPEQDFSQQH
DKTDRLLAAFPAIMCYWYRFSHQGQRIECVTDEVSIGGHFLHLLHGKKPSELHVKVMNVS
LILYAEHEFNASTFTARVCASTLSDLFSCITAAIGSLRGPLHGGANEAAMEMIERFSSPQ
EAIEGTLGMLARKDKIMGFGHAIYKDNDPRNEVIKGWSKKLADEVGDTVLFPVSEAIDKT
MWEQKKLFPNADFYHASAYHFMGIPTKLFTPIFVCSRLTGWAAHVFEQRANNRIIRPSAE
YTGVEQRKFVPIEQR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory