SitesBLAST
Comparing Pf6N2E2_629 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_629 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
34% identity, 94% coverage: 4:307/324 of query aligns to 2:297/301 of 1v1aA
- active site: G248 (= G258), A249 (= A259), G250 (= G260), D251 (= D261)
- binding adenosine-5'-diphosphate: K219 (= K228), G221 (= G230), A222 (= A231), A249 (= A259), G250 (= G260), N275 (= N285), A279 (≠ S289)
- binding 2-keto-3-deoxygluconate: L11 (≠ M13), G34 (= G36), A35 (= A37), N38 (= N40), Y89 (≠ Q92), R105 (= R109), R167 (= R170), G248 (= G258), D251 (= D261), D287 (= D297)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
34% identity, 94% coverage: 4:307/324 of query aligns to 2:297/309 of Q53W83
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
34% identity, 94% coverage: 4:307/324 of query aligns to 2:297/300 of 1v1bA
- active site: G248 (= G258), A249 (= A259), G250 (= G260), D251 (= D261)
- binding adenosine-5'-triphosphate: K219 (= K228), G221 (= G230), A238 (≠ P249), F239 (≠ V250), V241 (vs. gap), G248 (= G258), A249 (= A259), G250 (= G260), N275 (= N285), A279 (≠ S289)
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
33% identity, 91% coverage: 16:309/324 of query aligns to 6:303/306 of 5eynA
- active site: G246 (= G258), A247 (= A259), G248 (= G260), D249 (= D261)
- binding adenosine-5'-diphosphate: H91 (≠ G100), T217 (≠ K228), G219 (= G230), A220 (= A231), A238 (≠ P249), V239 (= V250), T244 (= T256), G246 (= G258), A247 (= A259), G248 (= G260), F251 (= F263), N279 (= N285), G282 (= G288), A283 (≠ S289)
- binding beryllium trifluoride ion: G246 (= G258), G248 (= G260), D249 (= D261)
- binding beta-D-fructofuranose: D9 (= D19), D13 (= D23), G28 (= G36), A29 (= A37), N32 (= N40), F96 (≠ V105), F98 (≠ Y107), R159 (= R170), D249 (= D261)
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
33% identity, 91% coverage: 16:309/324 of query aligns to 10:307/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (≠ L195), T221 (≠ K228), G223 (= G230), A242 (≠ P249), V243 (= V250), F255 (= F263), N283 (= N285), G286 (= G288), A287 (≠ S289)
- binding beta-D-fructofuranose: D13 (= D19), D17 (= D23), G32 (= G36), A33 (= A37), F100 (≠ V105), F102 (≠ Y107), R163 (= R170), D253 (= D261)
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
31% identity, 92% coverage: 6:303/324 of query aligns to 3:297/308 of 2dcnA
- active site: G252 (= G258), A253 (= A259), G254 (= G260), D255 (= D261)
- binding adenosine-5'-diphosphate: D193 (≠ G197), K223 (= K228), G225 (= G230), P226 (≠ A231), G228 (= G233), V247 (= V250), G254 (= G260), I279 (≠ N285), S282 (≠ G288), V286 (= V292)
- binding 6-O-phosphono-beta-D-psicofuranosonic acid: G33 (= G36), F89 (≠ Q92), Y105 (= Y107), R107 (= R109), I136 (= I137), R165 (= R170), T251 (≠ V257), G252 (= G258), D255 (= D261), D291 (= D297)
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
29% identity, 92% coverage: 5:303/324 of query aligns to 2:299/311 of 2varA
- active site: G254 (= G258), A255 (= A259), G256 (= G260), D257 (= D261)
- binding adenosine monophosphate: G227 (= G230), G230 (= G233), M259 (≠ F263), S284 (≠ G288), I288 (≠ V292)
- binding phosphoaminophosphonic acid-adenylate ester: K225 (= K228), G227 (= G230), S228 (≠ A231), G230 (= G233), G254 (= G258), A255 (= A259), G256 (= G260), D257 (= D261), M259 (≠ F263), I281 (≠ N285), S284 (≠ G288), I288 (≠ V292)
- binding 3-deoxy-alpha-D-erythro-hex-2-ulofuranosonic acid: L10 (≠ M13), G33 (= G36), S34 (≠ A37), Y89 (≠ Q92), Y105 (= Y107), R107 (= R109), I136 (= I137), R165 (= R170), G254 (= G258), D257 (= D261)
- binding 2-keto-3-deoxygluconate: G33 (= G36), S34 (≠ A37), Y89 (≠ Q92), L103 (≠ V105), Y105 (= Y107), R107 (= R109), I136 (= I137), R165 (= R170), T253 (≠ V257), G254 (= G258), D257 (= D261), D293 (= D297)
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
29% identity, 92% coverage: 5:303/324 of query aligns to 3:300/313 of Q97U29
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 89% coverage: 16:302/324 of query aligns to 9:298/319 of Q8ZKR2
- D16 (= D23) binding
- G31 (= G36) binding
- Y101 (= Y107) binding
- R162 (= R170) binding
- A180 (= A188) binding
- A181 (= A189) binding
- A183 (= A191) binding
- G213 (= G221) binding
- D246 (= D255) binding
- T248 (≠ V257) binding
- D252 (= D261) binding
- A287 (= A291) binding
- A290 (≠ S294) binding
- G292 (= G296) binding
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
29% identity, 89% coverage: 16:302/324 of query aligns to 5:287/297 of 1tz6A
- active site: C24 (≠ R33), F88 (≠ V105), G238 (= G258), A239 (= A259), G240 (= G260), D241 (= D261)
- binding phosphomethylphosphonic acid adenylate ester: N149 (= N168), K176 (≠ L195), E181 (= E200), S209 (≠ K228), G211 (= G230), A212 (= A231), G214 (= G233), A239 (= A259), G240 (= G260), F243 (= F263), N270 (= N285), G273 (= G288), A274 (≠ S289)
- binding 5-aminoimidazole ribonucleoside: D8 (= D19), D12 (= D23), G27 (= G36), F88 (≠ V105), Y90 (= Y107), R151 (= R170), M154 (≠ L173), D241 (= D261)
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
29% identity, 89% coverage: 16:302/324 of query aligns to 5:287/299 of 1tz3A
- active site: C24 (≠ R33), F88 (≠ V105), G238 (= G258), A239 (= A259), G240 (= G260), D241 (= D261)
- binding 5-aminoimidazole ribonucleoside: D8 (= D19), S10 (≠ R21), D12 (= D23), G27 (= G36), L83 (≠ Q92), F88 (≠ V105), Y90 (= Y107), R151 (= R170), M154 (≠ L173), D241 (= D261)
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
29% identity, 86% coverage: 32:311/324 of query aligns to 32:311/312 of 3in1A
- active site: R106 (≠ D102), G255 (= G258), A256 (= A259), G257 (= G260), D258 (= D261)
- binding adenosine-5'-diphosphate: N194 (≠ G197), K225 (= K228), G227 (= G230), G230 (= G233), A244 (≠ G247), T253 (= T256), N282 (= N285), A285 (≠ G288)
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 94% coverage: 6:308/324 of query aligns to 2:293/302 of 3gbuA
- active site: G242 (= G258), A243 (= A259), G244 (= G260), D245 (= D261)
- binding adenosine-5'-triphosphate: K188 (≠ D209), T213 (≠ K228), G215 (= G230), V235 (= V253), P237 (vs. gap), A243 (= A259), G244 (= G260), A274 (≠ G288)
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
28% identity, 94% coverage: 6:308/324 of query aligns to 3:294/304 of 3ih0A
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
29% identity, 81% coverage: 45:307/324 of query aligns to 45:301/308 of 3iq0B
- active site: G252 (= G258), A253 (= A259), G254 (= G260), D255 (= D261)
- binding adenosine-5'-triphosphate: S192 (≠ G197), K223 (= K228), G225 (= G230), E247 (≠ Q252), A253 (= A259), G254 (= G260), F257 (= F263), N279 (= N285), G282 (= G288)
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
31% identity, 90% coverage: 6:298/324 of query aligns to 17:303/306 of 4ebuA
- active site: A263 (≠ G258), A264 (= A259), G265 (= G260), D266 (= D261)
- binding adenosine-5'-diphosphate: S202 (≠ G197), K233 (= K228), G235 (= G230), V255 (= V250), A264 (= A259), G265 (= G260), F268 (= F263), A293 (≠ G288)
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
31% identity, 84% coverage: 6:277/324 of query aligns to 17:278/294 of 4eumA
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
31% identity, 75% coverage: 30:271/324 of query aligns to 30:265/312 of 4wjmA
- active site: G252 (= G258), A253 (= A259), G254 (= G260), D255 (= D261)
- binding phosphoaminophosphonic acid-adenylate ester: T223 (≠ K228), G225 (= G230), A226 (= A231), G228 (= G233), G252 (= G258), A253 (= A259), G254 (= G260), V257 (≠ F263)
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
29% identity, 74% coverage: 34:273/324 of query aligns to 24:242/282 of 7fcaD
1gqtB Activation of ribokinase by monovalent cations (see paper)
26% identity, 88% coverage: 22:307/324 of query aligns to 27:300/307 of 1gqtB
- active site: A251 (≠ G258), A252 (= A259), G253 (= G260), D254 (= D261)
- binding phosphomethylphosphonic acid adenylate ester: N186 (≠ G197), T222 (≠ K228), G224 (= G230), S225 (≠ A231), A252 (= A259), G253 (= G260), H278 (≠ N285), A281 (≠ G288)
- binding cesium ion: D248 (= D255), I250 (≠ V257), A284 (= A291), R287 (≠ S294), S293 (≠ G300)
- binding alpha-D-ribofuranose: G41 (= G36), N45 (= N40), E142 (≠ S149), D254 (= D261)
Sites not aligning to the query:
Query Sequence
>Pf6N2E2_629 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_629
MPEFDVLSFGETMAMLVADQRGDLASVDQFHKRIAGADSNVAIGLSRLDFKVAWLSRVGA
DSLGRFVVQTLENEGLDCRHVAVDPTHPTGFQFKSRTDDGSDPQVEYFRRGSAASHLSID
SIAPSLLEARHLHATGIVPALSVTAREMSFELMSRMRAAGRSLSFDPNMRPSLWGSESTM
ITEINRLAALAHWVLPGLGEGRLLTGFDDPADIAAFYLDQGAELVVIKLGADGAYYRTAL
DQGVIPGVPVAQVVDTVGAGDGFAVGLISALLEGQAITEAVQRANWIGSRAVQSRGDMEG
LPTRIELLAEFNDANREQARSNRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory