SitesBLAST
Comparing Pf6N2E2_668 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_668 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ie0B X-ray crystal structure of 2r,3r-butanediol dehydrogenase from bacillus subtilis
41% identity, 97% coverage: 10:361/364 of query aligns to 1:346/347 of 6ie0B
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
35% identity, 93% coverage: 22:360/364 of query aligns to 14:344/347 of 5vm2A
- active site: C39 (= C48), G40 (= G49), S41 (= S50), H44 (= H53), H65 (= H81), E66 (= E82), C95 (= C111), C98 (= C114), C101 (= C117), C109 (= C125), D113 (≠ A129), P153 (= P167), G157 (= G171), K340 (= K356)
- binding magnesium ion: H65 (= H81), E66 (= E82), E152 (= E166)
- binding zinc ion: C95 (= C111), C98 (= C114), C101 (= C117), C109 (= C125)
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
31% identity, 96% coverage: 13:360/364 of query aligns to 4:345/348 of 1e3jA
- active site: C38 (= C48), G39 (= G49), S40 (= S50), H43 (= H53), H63 (= H81), E64 (= E82), C93 (= C111), C96 (= C114), C99 (= C117), C107 (= C125), T111 (≠ A129), P150 (= P167), G154 (= G171), K341 (= K356)
- binding phosphate ion: A174 (= A191), A196 (= A218), R197 (= R219), S198 (≠ K220), R201 (≠ A223)
- binding zinc ion: C38 (= C48), H63 (= H81), E64 (= E82), C93 (= C111), C96 (= C114), C99 (= C117), C107 (= C125)
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
33% identity, 93% coverage: 6:345/364 of query aligns to 2:333/354 of P07846
- C43 (= C48) binding
- Y49 (= Y55) binding
- H67 (= H81) binding
- E68 (= E82) binding
- E153 (= E166) binding
- R296 (≠ A307) binding
- Y297 (= Y308) binding
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
33% identity, 91% coverage: 15:345/364 of query aligns to 7:330/351 of 3qe3A
- active site: C39 (= C48), G40 (= G49), S41 (= S50), H44 (= H53), H64 (= H81), E65 (= E82), R94 (≠ C111), D97 (≠ C114), C100 (= C117), S108 (≠ C125), F112 (≠ A129), P151 (= P167), G155 (= G171)
- binding glycerol: Y45 (≠ E54), F54 (= F61), T116 (≠ L133), R293 (≠ A307)
- binding zinc ion: C39 (= C48), H64 (= H81), E65 (= E82)
Sites not aligning to the query:
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
33% identity, 91% coverage: 15:347/364 of query aligns to 13:338/357 of Q00796
- C45 (= C48) binding
- H70 (= H81) binding
- E71 (= E82) binding
- R110 (≠ L121) to P: in SORDD; results in protein aggregation
- H135 (≠ V145) to R: in SORDD; results in protein aggregation
- A153 (= A163) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I194) binding
- D204 (≠ E214) binding
- R209 (= R219) binding
- Q239 (≠ G249) to L: in dbSNP:rs1042079
- N269 (≠ K277) to T: in dbSNP:rs930337
- VGL 273:275 (≠ VGI 281:283) binding
- VFR 297:299 (≠ ALA 305:307) binding
- V322 (= V330) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pl6A Human sdh/nadh/inhibitor complex (see paper)
33% identity, 91% coverage: 15:347/364 of query aligns to 12:337/356 of 1pl6A
- active site: C44 (= C48), G45 (= G49), S46 (= S50), H49 (= H53), H69 (= H81), E70 (= E82), R99 (≠ C111), D102 (≠ C114), C105 (= C117), S113 (≠ C125), F117 (≠ A129), P156 (= P167), G160 (= G171)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C48), S46 (= S50), I56 (≠ V60), F59 (= F61), H69 (= H81), E155 (= E166), L274 (≠ I283), F297 (≠ L306)
- binding nicotinamide-adenine-dinucleotide: G181 (= G192), P182 (≠ T193), I183 (= I194), D203 (≠ E214), L204 (≠ M215), R208 (= R219), C249 (= C258), T250 (≠ I259), V272 (= V281), G273 (= G282), L274 (≠ I283), F297 (≠ L306), R298 (≠ A307)
- binding zinc ion: C44 (= C48), H69 (= H81)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
34% identity, 91% coverage: 26:355/364 of query aligns to 23:343/348 of O58389
- C42 (= C48) binding
- T44 (≠ S50) mutation to A: Total loss of enzymatic activity.
- H67 (= H81) binding
- E68 (= E82) binding
- C97 (= C111) binding
- C100 (= C114) binding
- C103 (= C117) binding
- C111 (= C125) binding
- E152 (= E166) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I194) binding
- E199 (= E214) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R219) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ VGI 281:283) binding
- IT 291:292 (vs. gap) binding
- R294 (vs. gap) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
34% identity, 91% coverage: 26:355/364 of query aligns to 21:341/346 of 2dfvA
- active site: C40 (= C48), G41 (= G49), T42 (≠ S50), H45 (= H53), H65 (= H81), E66 (= E82), C95 (= C111), C98 (= C114), C101 (= C117), C109 (= C125), K113 (≠ A129), P151 (= P167), A155 (≠ G171), K340 (≠ N354)
- binding nicotinamide-adenine-dinucleotide: G175 (= G192), P176 (≠ T193), L177 (≠ I194), E197 (= E214), P198 (≠ M215), R202 (= R219), F241 (≠ C258), S242 (≠ I259), A244 (≠ N261), L264 (≠ V281), G265 (= G282), L266 (≠ I283), I289 (vs. gap), T290 (vs. gap)
- binding zinc ion: C95 (= C111), C101 (= C117), C109 (= C125)
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
33% identity, 91% coverage: 26:355/364 of query aligns to 23:343/350 of Q5JI69
- L179 (≠ I194) binding
- E199 (= E214) binding
- R204 (= R219) binding
- LGL 266:268 (≠ VGI 281:283) binding
- IT 291:292 (vs. gap) binding
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
33% identity, 91% coverage: 26:355/364 of query aligns to 21:341/347 of 3gfbA
- active site: C40 (= C48), G41 (= G49), T42 (≠ S50), H45 (= H53), H65 (= H81), E66 (= E82), C95 (= C111), C98 (= C114), C101 (= C117), C109 (= C125), K113 (≠ A129), P151 (= P167), A155 (≠ G171), K340 (≠ N354)
- binding nicotinamide-adenine-dinucleotide: G173 (= G190), G175 (= G192), P176 (≠ T193), L177 (≠ I194), S196 (≠ L213), E197 (= E214), P198 (≠ M215), R202 (= R219), F241 (≠ C258), S242 (≠ I259), A244 (≠ N261), L264 (≠ V281), G265 (= G282), L266 (≠ I283), I289 (vs. gap), T290 (vs. gap)
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
31% identity, 97% coverage: 11:362/364 of query aligns to 4:343/343 of 4ej6A
- active site: C40 (= C48), G41 (= G49), T42 (≠ S50), H45 (= H53), H61 (= H81), E62 (= E82), C91 (= C111), C94 (= C114), C97 (= C117), C105 (= C125), R109 (≠ A129), P147 (= P167), C151 (≠ G171), K337 (= K356)
- binding zinc ion: C91 (= C111), C94 (= C114), C97 (= C117), C105 (= C125)
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
32% identity, 90% coverage: 11:338/364 of query aligns to 4:322/342 of 4ejmA
- active site: C40 (= C48), G41 (= G49), T42 (≠ S50), H45 (= H53), H61 (= H81), E62 (= E82), C91 (= C111), C94 (= C114), C97 (= C117), C105 (= C125), R109 (≠ A129), P147 (= P167), C151 (≠ G171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G190), G172 (= G192), V173 (≠ T193), I174 (= I194), T194 (≠ E214), R195 (≠ M215), Q196 (≠ S216), K199 (≠ R219), C240 (= C258), E245 (≠ H263), T246 (= T264), L263 (≠ V281), V265 (≠ I283), I291 (≠ A307)
- binding zinc ion: C91 (= C111), C94 (= C114), C97 (= C117), C105 (= C125)
Sites not aligning to the query:
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
32% identity, 91% coverage: 15:345/364 of query aligns to 13:336/357 of P27867
2eerB Structural study of project id st2577 from sulfolobus tokodaii strain7
31% identity, 93% coverage: 22:359/364 of query aligns to 13:346/347 of 2eerB
- active site: C38 (= C48), H39 (≠ G49), S40 (= S50), H43 (= H53), H68 (= H81), E69 (= E82), E98 (≠ C111), C101 (= C114), C104 (= C117), C112 (= C125), R116 (≠ A129), C154 (≠ E166), T158 (≠ V170), R342 (≠ V355)
- binding nicotinamide-adenine-dinucleotide: C38 (= C48), H39 (≠ G49), S40 (= S50), H43 (= H53), C154 (≠ E166), T158 (≠ V170), G178 (= G190), G181 (≠ T193), G182 (vs. gap), L183 (≠ I194), D203 (≠ E214), V204 (≠ M215), R205 (≠ S216), L247 (≠ C258), N248 (≠ I259), V270 (= V281), G271 (= G282), L272 (≠ I283), F273 (= F284), L295 (= L306), V296 (≠ A307), R342 (≠ V355)
- binding zinc ion: E98 (≠ C111), C101 (= C114), C104 (= C117), C112 (= C125)
4uejA Closed state of galactitol-1-phosphate 5-dehydrogenase from e. Coli in complex with glycerol. (see paper)
29% identity, 93% coverage: 11:350/364 of query aligns to 1:336/346 of 4uejA
- active site: C38 (= C48), G39 (= G49), S40 (= S50), P43 (≠ H53), H59 (= H81), E60 (= E82), C89 (= C111), C92 (= C114), C95 (= C117), C103 (= C125), D107 (≠ A129), P145 (= P167), G149 (= G171)
- binding glycerol: H59 (= H81), E144 (= E166)
- binding zinc ion: C89 (= C111), C92 (= C114), C95 (= C117), C103 (= C125)
Sites not aligning to the query:
4a2cA Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli (see paper)
29% identity, 93% coverage: 11:350/364 of query aligns to 1:336/346 of 4a2cA
- active site: C38 (= C48), G39 (= G49), S40 (= S50), P43 (≠ H53), H59 (= H81), E60 (= E82), C89 (= C111), C92 (= C114), C95 (= C117), C103 (= C125), D107 (≠ A129), P145 (= P167), G149 (= G171)
- binding zinc ion: C89 (= C111), C92 (= C114), C95 (= C117), C103 (= C125)
Sites not aligning to the query:
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
32% identity, 92% coverage: 26:361/364 of query aligns to 17:341/343 of 2ejvA
- active site: C38 (= C48), G39 (= G49), T40 (≠ S50), H43 (= H53), H63 (= H81), E64 (= E82), C93 (= C111), C96 (= C114), C99 (= C117), C107 (= C125), Q111 (≠ A129), P149 (= P167), A153 (≠ G171), K336 (= K356)
- binding nicotinamide-adenine-dinucleotide: G172 (= G190), G174 (= G192), P175 (≠ T193), I176 (= I194), S195 (≠ L213), D196 (≠ E214), P197 (≠ M215), R201 (= R219), F238 (≠ C258), S239 (≠ I259), N241 (= N261), A244 (≠ T264), L261 (≠ V281), G262 (= G282), I263 (= I283)
- binding zinc ion: C38 (= C48), H63 (= H81), E64 (= E82), C96 (= C114), C99 (= C117), C107 (= C125)
2dq4A Crystal structure of threonine 3-dehydrogenase
32% identity, 92% coverage: 26:361/364 of query aligns to 17:341/343 of 2dq4A
- active site: C38 (= C48), G39 (= G49), T40 (≠ S50), H43 (= H53), H63 (= H81), E64 (= E82), C93 (= C111), C96 (= C114), C99 (= C117), C107 (= C125), Q111 (≠ A129), P149 (= P167), A153 (≠ G171), K336 (= K356)
- binding zinc ion: C38 (= C48), H63 (= H81), E64 (= E82), C93 (= C111), C96 (= C114), C107 (= C125)
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
32% identity, 92% coverage: 26:361/364 of query aligns to 17:341/343 of Q5SKS4
Query Sequence
>Pf6N2E2_668 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_668
MNVSIKPTRSMRAAVWHGRNDIRVEDVPLPVSPPAGWVQIRVQWCGICGSDLHEYVAGPV
FIPVDAPHPLTGIKGQCILGHEFCGEIVELGAGVEGFSVGEPVAADACQHCGTCYYCTHG
LYNICENLAFTGLMNNGAFAELVNVPANLLYKLPADFPAEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSGARKAKALEVGASHVIDPNECDAL
AEVRRLTGGLGADVSFECIGNKHTAKLAIDLIRKAGKCVLVGIFEEPSQFNFFELVSTEK
QVLGALAYNGEFADVIAFIADGRLDISPLVTGRIQLEEIVGQGFEELVNNKEHNVKIIVS
PARI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory