Comparing Pf6N2E2_670 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_670 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
28% identity, 90% coverage: 7:280/305 of query aligns to 3:282/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
28% identity, 90% coverage: 7:280/305 of query aligns to 3:282/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 90% coverage: 7:280/305 of query aligns to 3:282/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 90% coverage: 7:280/305 of query aligns to 3:282/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 90% coverage: 7:280/305 of query aligns to 3:282/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
28% identity, 90% coverage: 7:280/305 of query aligns to 3:282/298 of 3nevA
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
27% identity, 92% coverage: 9:290/305 of query aligns to 5:287/291 of 3na8A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
28% identity, 78% coverage: 7:244/305 of query aligns to 2:239/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
28% identity, 78% coverage: 7:244/305 of query aligns to 2:239/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
28% identity, 78% coverage: 7:244/305 of query aligns to 3:240/293 of 5t25A
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
27% identity, 78% coverage: 7:244/305 of query aligns to 2:239/292 of 3i7sA
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
28% identity, 88% coverage: 6:272/305 of query aligns to 1:273/307 of 5c55A
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
27% identity, 88% coverage: 6:274/305 of query aligns to 4:273/295 of 5ktlA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 78% coverage: 7:244/305 of query aligns to 2:239/292 of Q07607
4pfmA Shewanella benthica dhdps with lysine and pyruvate
28% identity, 75% coverage: 8:235/305 of query aligns to 4:231/295 of 4pfmA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
29% identity, 78% coverage: 7:244/305 of query aligns to 2:240/294 of Q8UGL3
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
28% identity, 78% coverage: 8:244/305 of query aligns to 3:239/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
28% identity, 78% coverage: 8:244/305 of query aligns to 3:239/292 of 3puoA
Sites not aligning to the query:
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
29% identity, 78% coverage: 7:244/305 of query aligns to 2:240/294 of 4i7wA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
25% identity, 69% coverage: 8:217/305 of query aligns to 3:212/291 of 4dxvA
>Pf6N2E2_670 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_670
MSKRINWSGVFPAVTTQFNDDFSINLEKTHQVISNVIRDGVSGLVVCGSVGENTSLSAEE
KIAVTEVAVDASRGRVPVICGVAEFTSVQAAKVANAVRKVGVDGVMLMPALVYGSKPFET
AEHFRYVARHADVPLMVYNNPPIYKNDVTPDILISLADCDNVVCFKDSSGDTRRFIDVRN
EVGDRFVLFAGLDDVVLESLAVGAEGWVSGMSNVFPQEGETIFRLARAGRFAEAMPIYEW
LMPILHLDARADLVQCIKLCEAIAGRGSALTRPPRLALPEEDRLYVEQIMAKAMANRPVL
PDVGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory