SitesBLAST
Comparing Pf6N2E2_80 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_80 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 90% coverage: 1:355/394 of query aligns to 6:349/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I2), G8 (= G3), G10 (= G5), V11 (≠ Y6), I12 (≠ T7), V30 (≠ L25), E31 (= E26), K32 (≠ A27), E38 (≠ G33), A39 (= A34), S40 (= S35), A43 (≠ N38), G45 (= G40), L46 (≠ Q41), V171 (≠ A176), G200 (= G203), G201 (≠ N204), W203 (≠ Y206), G298 (= G306), R300 (≠ F308), P301 (≠ L309), Y326 (vs. gap), R327 (vs. gap), N328 (vs. gap), G329 (= G335), I330 (≠ V336)
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
23% identity, 67% coverage: 91:353/394 of query aligns to 92:349/369 of O31616
- V174 (≠ A176) binding
- H244 (≠ Y244) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ F308) binding
- 327:333 (vs. 331:337, 14% identical) binding
- R329 (≠ G333) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
23% identity, 67% coverage: 91:353/394 of query aligns to 92:349/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (= Y251), R302 (≠ F308), R329 (≠ G333)
- binding flavin-adenine dinucleotide: V174 (≠ A176), S202 (≠ G203), G203 (≠ N204), W205 (≠ Y206), F209 (≠ L210), G300 (= G306), R302 (≠ F308), H327 (≠ C331), R329 (≠ G333), N330 (≠ H334), G331 (= G335), I332 (≠ V336)
- binding phosphate ion: R254 (= R263)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
22% identity, 67% coverage: 91:353/394 of query aligns to 92:349/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (= P175), V174 (≠ A176), S202 (≠ G203), G203 (≠ N204), W205 (≠ Y206), F209 (≠ L210), G300 (= G306), R302 (≠ F308), H327 (≠ C331), F328 (≠ S332), R329 (≠ G333), N330 (≠ H334), G331 (= G335), I332 (≠ V336)
- binding glycolic acid: Y246 (= Y251), R302 (≠ F308), R329 (≠ G333)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
Query Sequence
>Pf6N2E2_80 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_80
VIGAGYTGLSSALFLLENGFKVTVLEAAKVGFGASGRNGGQIVNSYSRDIDVIERSVGPQ
QAQLLGNMAFEGGRIIRERVAKYQIQCDLKDGGVFAALTAKQMGHLESQKRLWERFGHTQ
LELLDQRRIREVVACEEYVGGMLDMSGGHIHPLNLALGEAAAVESLGGVIYEQSPAVRIE
RGASPVVHTPQGKVRAKFIIVAGNAYLGNLVPELAAKSMPCGTQVIATEPLGDELAHSLL
PQDYCVEDCNYLLDYYRLTGDKRLIFGGGVVYGARDPANIEAIIRPKMLKAFPQLKDVKI
DYAWTGNFLLTLSRLPQVGRLGDNIYYSQGCSGHGVTYTHLAGKVLAEALRGQAERFDAF
ADLPHYPFPGGQLLRTPFAAMGAWYYGLRDKLGF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory