Comparing Pf6N2E2_801 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_801 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
7cdyA Crystal structure of glucose dehydrogenase
67% identity, 90% coverage: 39:380/382 of query aligns to 3:344/346 of 7cdyA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
59% identity, 97% coverage: 9:379/382 of query aligns to 5:367/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
62% identity, 90% coverage: 36:379/382 of query aligns to 2:345/348 of 2g8sA
7cgzA Glucose dehydrogenase
61% identity, 90% coverage: 39:380/382 of query aligns to 3:319/321 of 7cgzA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
36% identity, 88% coverage: 37:374/382 of query aligns to 2:318/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
34% identity, 89% coverage: 34:374/382 of query aligns to 1:319/338 of 3a9hA
Sites not aligning to the query:
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
34% identity, 89% coverage: 34:374/382 of query aligns to 1:319/338 of 3a9gA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
32% identity, 89% coverage: 34:374/382 of query aligns to 5:317/334 of 3dasA
Sites not aligning to the query:
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
26% identity, 98% coverage: 2:376/382 of query aligns to 1:460/478 of P13650
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
27% identity, 92% coverage: 25:376/382 of query aligns to 5:436/453 of 5minB
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
27% identity, 92% coverage: 25:376/382 of query aligns to 5:434/448 of 1cruA
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
27% identity, 92% coverage: 25:376/382 of query aligns to 5:430/444 of 1cq1A
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
27% identity, 92% coverage: 25:376/382 of query aligns to 5:430/444 of 1c9uA
7pgnB Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
23% identity, 59% coverage: 39:262/382 of query aligns to 6:242/438 of 7pgnB
Sites not aligning to the query:
7pgnA Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
23% identity, 53% coverage: 39:240/382 of query aligns to 7:225/437 of 7pgnA
Sites not aligning to the query:
Q96QV1 Hedgehog-interacting protein; HHIP; HIP from Homo sapiens (Human) (see 3 papers)
22% identity, 61% coverage: 29:262/382 of query aligns to 209:474/700 of Q96QV1
7pgmB Hhip-c in complex with heparin (see paper)
23% identity, 51% coverage: 39:234/382 of query aligns to 6:213/427 of 7pgmB
Sites not aligning to the query:
2wfxB Crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog in the presence of calcium (see paper)
22% identity, 59% coverage: 39:262/382 of query aligns to 5:246/417 of 2wfxB
Sites not aligning to the query:
>Pf6N2E2_801 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_801
MLRKTLLAAFCASAVLALATPANAAPTQSFKSEEGTLEVTTVVKGLEHPWSVAFLPGQQG
MLVTERPGNLRVVSADGQLSAPLSGVPEVWAKGQGGLLDVVLSPDFKQDRTVYLSYAEAG
ADGKAGTAVGRGQLSEDLKSLKNFDVIFRQLPKLSTGNHFGSRLVFDRDGYLFITLGENN
ERPTAQDLDKLQGKIVRIYPDGKVPDDNPFVGQKNVRPEIWSYGMRNPQGAALNPWNGTL
WENEHGPKGGDEMNIIERGKNYGWPLATHGINYSGAPIPEAQGKTVEGGLDPHHVWQVSP
GLSGMAFYDHGRFKAWQHNVFIGALVPGELIRLQLQDDKIVHEERLLGELKARIRDVRQG
PDGYLYVLTDEDDGALYKVGLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory