Comparing Pf6N2E2_804 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_804 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
34% identity, 100% coverage: 1:311/312 of query aligns to 7:312/312 of 4wjmA
7fcaD Pfkb(mycobacterium marinum) (see paper)
35% identity, 96% coverage: 3:302/312 of query aligns to 5:281/282 of 7fcaD
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
29% identity, 93% coverage: 4:294/312 of query aligns to 6:300/306 of 5eynA
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
30% identity, 88% coverage: 21:294/312 of query aligns to 20:304/310 of 5yggA
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
29% identity, 98% coverage: 5:311/312 of query aligns to 5:292/302 of 3gbuA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
29% identity, 98% coverage: 5:311/312 of query aligns to 6:293/304 of 3ih0A
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 94% coverage: 21:312/312 of query aligns to 19:304/319 of Q8ZKR2
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
28% identity, 94% coverage: 21:312/312 of query aligns to 15:293/297 of 1tz6A
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
28% identity, 94% coverage: 21:312/312 of query aligns to 15:293/299 of 1tz3A
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
29% identity, 96% coverage: 3:302/312 of query aligns to 6:302/322 of 3lkiB
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
27% identity, 76% coverage: 33:269/312 of query aligns to 36:267/308 of 3iq0B
Sites not aligning to the query:
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
26% identity, 78% coverage: 26:267/312 of query aligns to 32:265/306 of 4xckA
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
27% identity, 92% coverage: 26:312/312 of query aligns to 30:295/300 of 8cqxA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 74% coverage: 32:262/312 of query aligns to 33:259/309 of Q53W83
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
29% identity, 74% coverage: 32:262/312 of query aligns to 33:259/300 of 1v1bA
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
29% identity, 74% coverage: 32:262/312 of query aligns to 33:259/301 of 1v1aA
Sites not aligning to the query:
6znxC Ribokinase from thermus species
26% identity, 92% coverage: 26:312/312 of query aligns to 17:260/265 of 6znxC
2fv7A Crystal structure of human ribokinase
25% identity, 90% coverage: 32:311/312 of query aligns to 38:303/308 of 2fv7A
5c3yA Structure of human ribokinase crystallized with amppnp
25% identity, 90% coverage: 32:311/312 of query aligns to 38:303/306 of 5c3yA
5byfA Crystal structure of human ribokinase in complex with amp
25% identity, 90% coverage: 32:311/312 of query aligns to 40:305/313 of 5byfA
>Pf6N2E2_804 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_804
MYLVCGEALFDFFSETEADGPASQVNYKAIAGGSPFNVAVGLRRLGVESALFTGLSTDYL
GRRLHQVLLNEGVSAQYLVDFDAPTTLAMVAVGANGSPHYSFRGEGCADRQLSLAHLPDL
GPEVRGLHFGSFSLVVQPIADTLLALMQRESGRRLISLDPNVRLNPQPDIELWRSRIATL
VQYADLIKVSDEDLDLLYPAKEPEAIIEGWLGNRCQLVFLTRGGQGATVFSRQHGSWSLP
SCPVKIADTVGAGDTFQAALIAWLTEQQLDSIEGLHTLTREQISAMLEFAIRAAALTCGK
TGPDLPYRHQLN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory