Comparing Pf6N2E2_883 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_883 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
35% identity, 90% coverage: 44:470/472 of query aligns to 21:437/446 of A0A0H2VG78
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 98% coverage: 9:472/472 of query aligns to 7:485/509 of Q8VZR6
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
31% identity, 94% coverage: 25:467/472 of query aligns to 7:475/491 of P0AGF4
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
31% identity, 94% coverage: 25:467/472 of query aligns to 3:471/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
31% identity, 94% coverage: 25:467/472 of query aligns to 3:471/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
31% identity, 94% coverage: 25:467/472 of query aligns to 3:471/475 of 4gbyA
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 72% coverage: 10:350/472 of query aligns to 10:355/580 of Q9C757
Sites not aligning to the query:
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 70% coverage: 27:356/472 of query aligns to 26:363/582 of O23492
Sites not aligning to the query:
P39004 High-affinity hexose transporter HXT7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 99% coverage: 3:467/472 of query aligns to 39:525/570 of P39004
Sites not aligning to the query:
P39003 High-affinity hexose transporter HXT6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 99% coverage: 3:467/472 of query aligns to 39:525/570 of P39003
Sites not aligning to the query:
Q9P3U7 Probable high-affinity hexose transporter ght8, mitochondrial; Hexose transporter 8 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 92% coverage: 36:468/472 of query aligns to 14:465/547 of Q9P3U7
Sites not aligning to the query:
O74969 High-affinity glucose transporter ght2; Hexose transporter 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 92% coverage: 36:468/472 of query aligns to 18:469/531 of O74969
Sites not aligning to the query:
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
27% identity, 93% coverage: 34:472/472 of query aligns to 14:465/469 of 7crzA
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
27% identity, 93% coverage: 34:472/472 of query aligns to 16:467/470 of 4zw9A
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
27% identity, 93% coverage: 34:472/472 of query aligns to 13:464/468 of 7spsA
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
27% identity, 93% coverage: 34:472/472 of query aligns to 16:467/496 of P11169
P32467 Low-affinity glucose transporter HXT4; Low-affinity glucose transporter LGT1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 99% coverage: 3:467/472 of query aligns to 44:531/576 of P32467
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
28% identity, 93% coverage: 34:472/472 of query aligns to 16:467/470 of 7sptA
P78831 High-affinity glucose transporter ght5; Hexose transporter 5 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 92% coverage: 36:468/472 of query aligns to 14:465/546 of P78831
Sites not aligning to the query:
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 92% coverage: 37:468/472 of query aligns to 95:547/592 of P38695
Sites not aligning to the query:
>Pf6N2E2_883 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_883
MTINSYGNTADTSAAYVSPEKHQAQRYLQKITWIATFGGLLFGFDTGVINGALLYMKDDL
GLTPFTEGLVASALLIGAMMGALFSGRLSDLKGRRRIILFLAVVFFLGALACALAPTLDV
MVAARFTLGLAVGGASVVVPAYLSEMAPSSIRGRIITRNELMIVTGQFLAFTTNATLGNL
FSDLDGVWRWMLALATLPAVALWLGMLYMPESPRWLATKGRFREGLEVLKLVREEYYAKA
EMEAITQQISNERFIKKGGWRDLSQKGARRIFLIGIGIAVTSQLTGVNSIMYFGTQILTE
AGLEQRSALIANVVNGIISIGATFVGIALLDRVGRRPMMLLGFTGTTLSLLLIGLVSVFV
DPSVTRAMLILGAMAMFLASMQGLIGPAFWVLLAEIFPMRIRGGCMGMAIAAFWLTNVMI
GMFFPSLVAMIGIGQTFFVFVGAGLLSLTFVAVWVPETRGSTLEEIEQRLYG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory