SitesBLAST
Comparing Pf6N2E2_885 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_885 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
33% identity, 98% coverage: 1:335/342 of query aligns to 1:337/337 of 3nt5A
- active site: K97 (= K96), H176 (= H175)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K96), H155 (= H154), H176 (= H175), Y235 (= Y232)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), G11 (= G11), A12 (≠ I12), I13 (≠ M13), D35 (= D35), V36 (≠ A36), S74 (= S73), W75 (≠ P74), G76 (≠ D75), E96 (= E95), K97 (= K96), Y280 (= Y277)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
33% identity, 98% coverage: 1:335/342 of query aligns to 1:337/337 of 3nt4A
- active site: K97 (= K96), H176 (= H175)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (= H154), H176 (= H175), Y235 (= Y232), W272 (= W269)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G11), A12 (≠ I12), I13 (≠ M13), D35 (= D35), V36 (≠ A36), S74 (= S73), W75 (≠ P74), G76 (≠ D75), E96 (= E95), K97 (= K96), H176 (= H175)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
33% identity, 98% coverage: 1:335/342 of query aligns to 1:337/337 of 3nt2B
- active site: K97 (= K96), H176 (= H175)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G9), G11 (= G11), A12 (≠ I12), D35 (= D35), V36 (≠ A36), S74 (= S73), W75 (≠ P74), A78 (≠ T77), K97 (= K96), W272 (= W269), Y280 (= Y277)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
33% identity, 98% coverage: 1:335/342 of query aligns to 1:337/337 of 3nt2A
- active site: K97 (= K96), H176 (= H175)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), G11 (= G11), A12 (≠ I12), I13 (≠ M13), D35 (= D35), V36 (≠ A36), S74 (= S73), W75 (≠ P74), G76 (≠ D75), A78 (≠ T77), H79 (= H78), E96 (= E95), K97 (= K96), H176 (= H175), Y280 (= Y277)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
33% identity, 98% coverage: 1:335/342 of query aligns to 1:337/337 of 4l8vA
- active site: K97 (= K96), H176 (= H175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ I12), I13 (≠ M13), S74 (= S73), W75 (≠ P74), H79 (= H78), E96 (= E95), K97 (= K96), M126 (= M125), W272 (= W269), Y280 (= Y277)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
31% identity, 98% coverage: 1:335/342 of query aligns to 1:336/336 of 3ec7A
- active site: K97 (= K96), H176 (= H175)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), M12 (≠ I12), I13 (≠ M13), D35 (= D35), I36 (≠ A36), R40 (= R40), T73 (≠ A72), A74 (≠ S73), S75 (≠ P74), N76 (≠ D75), H79 (= H78), E96 (= E95), K97 (= K96), M126 (= M125), W271 (= W269), Y279 (= Y277)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
31% identity, 98% coverage: 1:335/342 of query aligns to 1:339/339 of 4mjlD
- active site: K97 (= K96)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K96), H155 (= H154), N157 (= N156), D172 (≠ N171), T173 (≠ S172), H176 (= H175), Y236 (= Y232)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), A12 (≠ I12), M13 (= M13), D35 (= D35), I36 (≠ A36), V73 (≠ A72), S74 (= S73), H79 (= H78), E96 (= E95), K97 (= K96), M126 (= M125), D172 (≠ N171), W274 (= W269), Y282 (= Y277)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
31% identity, 98% coverage: 1:335/342 of query aligns to 1:339/339 of 4mioD
- active site: K97 (= K96)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K96), H155 (= H154), N157 (= N156), D172 (≠ N171), T173 (≠ S172), H176 (= H175), Y236 (= Y232)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ I12), M13 (= M13), D35 (= D35), I36 (≠ A36), S74 (= S73), A78 (≠ T77), H79 (= H78), E96 (= E95), K97 (= K96), M126 (= M125), D172 (≠ N171), W274 (= W269), Y282 (= Y277)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
31% identity, 98% coverage: 1:335/342 of query aligns to 1:339/339 of 4mioA
- active site: K97 (= K96)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G11), A12 (≠ I12), M13 (= M13), D35 (= D35), I36 (≠ A36), S74 (= S73), F75 (≠ P74), H79 (= H78), E96 (= E95), K97 (= K96), W274 (= W269), Y282 (= Y277)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
31% identity, 98% coverage: 1:335/342 of query aligns to 1:339/339 of 4minA
- active site: K97 (= K96)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), A12 (≠ I12), M13 (= M13), D35 (= D35), I36 (≠ A36), V73 (≠ A72), S74 (= S73), F75 (≠ P74), H79 (= H78), E96 (= E95), K97 (= K96), Y282 (= Y277)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
26% identity, 92% coverage: 2:315/342 of query aligns to 2:331/340 of 4n54A
- active site: K96 (= K96), H183 (= H175)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (≠ I12), K96 (= K96), D156 (≠ E158), D179 (vs. gap), M180 (vs. gap), H183 (= H175), R238 (≠ N226), Y244 (= Y232)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ I8), G9 (= G9), L10 (≠ A10), G11 (= G11), R12 (≠ I12), L13 (≠ M13), S35 (≠ D35), V36 (≠ A36), E40 (≠ R40), S73 (= S73), P74 (= P74), F77 (≠ T77), H78 (= H78), E95 (= E95), K96 (= K96), M125 (= M125), F167 (≠ I169), F284 (≠ R270)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
31% identity, 44% coverage: 3:153/342 of query aligns to 5:155/342 of 3ceaA
- active site: K98 (= K96)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), G13 (= G11), R14 (≠ I12), L15 (≠ M13), L38 (≠ A36), Q42 (≠ R40), V74 (≠ A72), A75 (≠ S73), P76 (= P74), T77 (≠ D75), F79 (≠ T77), H80 (= H78), M83 (≠ L81), E97 (= E95), K98 (= K96), M127 (= M125)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
25% identity, 72% coverage: 3:248/342 of query aligns to 2:252/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ I12), F152 (≠ H154), N154 (= N156), D175 (≠ N171), L176 (≠ S172), H179 (= H175), E236 (≠ Y232)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G11), F11 (≠ I12), M12 (= M13), D33 (= D35), L34 (≠ A36), T70 (≠ A72), T71 (≠ S73), P72 (= P74), N73 (≠ D75), L75 (≠ T77), H76 (= H78), Q79 (≠ L81), E93 (= E95), K94 (= K96), N122 (≠ Q118), W161 (≠ V157), H179 (= H175)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
25% identity, 72% coverage: 3:248/342 of query aligns to 2:252/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ I12), N154 (= N156), D175 (≠ N171), H179 (= H175), E236 (≠ Y232)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G9), G10 (= G11), F11 (≠ I12), M12 (= M13), D33 (= D35), L34 (≠ A36), T70 (≠ A72), T71 (≠ S73), P72 (= P74), N73 (≠ D75), L75 (≠ T77), H76 (= H78), Q79 (≠ L81), E93 (= E95), K94 (= K96), N122 (≠ Q118), W161 (≠ V157)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
25% identity, 72% coverage: 3:248/342 of query aligns to 2:252/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (≠ I12), M12 (= M13), D33 (= D35), L34 (≠ A36), T70 (≠ A72), T71 (≠ S73), P72 (= P74), N73 (≠ D75), L75 (≠ T77), H76 (= H78), Q79 (≠ L81), E93 (= E95), K94 (= K96), N122 (≠ Q118), W161 (≠ V157), H179 (= H175)
Sites not aligning to the query:
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
26% identity, 72% coverage: 2:248/342 of query aligns to 2:273/372 of 6a3iA
- binding Levoglucosan: K103 (= K96), Y132 (≠ R126), Y160 (≠ M149), Q162 (≠ H151), R175 (≠ S164), D188 (vs. gap), H192 (= H175)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (≠ I12), M13 (= M13), E42 (≠ D35), A43 (= A36), P81 (= P74), N82 (≠ D75), L84 (≠ T77), H85 (= H78), E102 (= E95), K103 (= K96), W174 (≠ F163), R175 (≠ S164)
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
26% identity, 72% coverage: 2:248/342 of query aligns to 1:277/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G11), F11 (≠ I12), M12 (= M13), E41 (≠ D35), T79 (≠ S73), P80 (= P74), N81 (≠ D75), H84 (= H78), E101 (= E95), K102 (= K96), W173 (≠ F163), R174 (≠ S164)
- binding alpha-L-sorbopyranose: K102 (= K96), Y131 (≠ R126), Y159 (≠ M149), Q161 (≠ H151), W163 (≠ F153), R174 (≠ S164), D187 (vs. gap)
6z3cAAA Gfo/Idh/MocA family oxidoreductase (see paper)
32% identity, 44% coverage: 2:152/342 of query aligns to 11:156/379 of 6z3cAAA
- binding nicotinamide-adenine-dinucleotide: G20 (= G11), Y21 (≠ I12), F22 (≠ M13), L42 (≠ C34), D43 (= D35), P44 (= P38), A77 (= A72), T78 (≠ S73), P79 (= P74), N80 (≠ D75), H83 (= H78), E100 (= E95), K101 (= K96), V129 (≠ M125)
Sites not aligning to the query:
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
27% identity, 58% coverage: 2:201/342 of query aligns to 3:218/390 of F0M433
- F13 (≠ I12) binding
- M14 (= M13) binding
- E43 (≠ D35) binding
- T81 (≠ S73) binding
- N83 (≠ D75) binding
- H86 (= H78) binding
- E103 (= E95) binding
- K104 (= K96) binding ; binding
- A130 (≠ G123) binding
- N132 (≠ M125) binding
- Y133 (≠ R126) binding
- Q163 (≠ H151) binding
- W175 (≠ F163) binding
- R176 (≠ S164) binding ; binding
- D189 (vs. gap) binding
- H193 (= H175) binding
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
29% identity, 63% coverage: 3:217/342 of query aligns to 2:223/333 of 4koaA
- active site: K94 (= K96), H180 (= H175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), A9 (= A10), S10 (≠ G11), T11 (≠ I12), I12 (≠ M13), S33 (≠ D35), S34 (≠ A36), R38 (= R40), T71 (≠ S73), N73 (≠ D75), H76 (= H78), K94 (= K96), Q160 (vs. gap)
Query Sequence
>Pf6N2E2_885 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_885
MSIRIAVIGAGIMGEDHARIIAQDLPGATLHVVCDASPERAKLIADRYGAADVSTDPLFT
LSRSDVDAIIIASPDETHAVLTMAAIEAGKPALCEKPLSQSPDQCLAVIDKEASRGRQFV
QLGFMRRFDPSYREMKSALSDGVIGRAVMMHNFHRNVEAPANFSGQMAISNSAPHEFDVA
RHVLDTEYVAISVFQPTHTSEDGVGAPVFMVLETREGHLVNIEINNNAHYGYDVRGELVG
ERGSVQLNTPVHTRFNTCLQGFERYAADWRPRFADAYRLQNKAFVAFINTGRFPVHAANA
WDGYCAAIVAQAGIEALNQRRRVVLPTLEAPPLYRSREGATS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory