Comparing Pf6N2E2_933 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_933 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6tahB Glutathione S-transferase
31% identity, 96% coverage: 4:200/206 of query aligns to 3:200/213 of 6tahB
Sites not aligning to the query:
4ecjA Crystal structure of glutathione s-transferase prk13972 (target efi- 501853) from pseudomonas aeruginosa pacs2 complexed with glutathione
31% identity, 96% coverage: 4:200/206 of query aligns to 2:199/204 of 4ecjA
4nhzH Crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., Target efi-507290, with one glutathione bound
26% identity, 98% coverage: 5:206/206 of query aligns to 33:246/246 of 4nhzH
4mf6A Crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit
26% identity, 95% coverage: 5:200/206 of query aligns to 27:234/240 of 4mf6A
3vwxC Structural analysis of an epsilon-class glutathione s-transferase from housefly, musca domestica (see paper)
29% identity, 91% coverage: 7:194/206 of query aligns to 4:194/220 of 3vwxC
4l8eA Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
26% identity, 94% coverage: 5:197/206 of query aligns to 1:199/203 of 4l8eA
7db0A Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in dimedone-bound form
29% identity, 97% coverage: 7:205/206 of query aligns to 6:205/225 of 7db0A
7db4A Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp012- and glutathione-bound form
29% identity, 97% coverage: 7:205/206 of query aligns to 5:204/225 of 7db4A
Sites not aligning to the query:
6keoAA Glutathione S-transferase E14 (see paper)
29% identity, 97% coverage: 7:205/206 of query aligns to 5:204/225 of 6keoAA
Sites not aligning to the query:
7dazA Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp015- and gsh-bound form
29% identity, 97% coverage: 7:205/206 of query aligns to 5:204/219 of 7dazA
Sites not aligning to the query:
7db3A Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp011-bound form
29% identity, 97% coverage: 7:205/206 of query aligns to 5:204/223 of 7db3A
7daxA Crystal structure of drosophila melanogaster noppera-bo, glutathione s-transferase epsilon 14 (dmgste14), in tdp013-bound form
29% identity, 97% coverage: 7:205/206 of query aligns to 5:204/224 of 7daxA
Sites not aligning to the query:
1byeA Glutathione s-transferase i from mais in complex with atrazine glutathione conjugate (see paper)
28% identity, 99% coverage: 3:206/206 of query aligns to 1:211/213 of 1byeA
4ivfF Crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit
25% identity, 98% coverage: 5:206/206 of query aligns to 4:217/227 of 4ivfF
6t2tA Crystal structure of drosophila melanogaster glutathione s-transferase epsilon 14 in complex with glutathione and 2-methyl-2,4-pentanediol (see paper)
29% identity, 97% coverage: 7:205/206 of query aligns to 5:204/229 of 6t2tA
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
25% identity, 94% coverage: 8:200/206 of query aligns to 7:202/219 of 3qawA
6nv6B Crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. Citri with glutathione bound (see paper)
29% identity, 95% coverage: 5:200/206 of query aligns to 4:202/207 of 6nv6B
1axdA Structure of glutathione s-transferase-i bound with the ligand lactoylglutathione (see paper)
28% identity, 95% coverage: 3:198/206 of query aligns to 1:204/209 of 1axdA
4zb8A Crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with oxidized glutathione. (see paper)
25% identity, 93% coverage: 7:198/206 of query aligns to 9:211/220 of 4zb8A
4zbdA Crystal structure of the glutathione transferase ure2p6 from phanerochaete chrysosporium in complex with glutathione reduced by x- ray irradiation at 100k (see paper)
25% identity, 93% coverage: 7:198/206 of query aligns to 8:210/219 of 4zbdA
>Pf6N2E2_933 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_933
MNAVIELYGAQTGNSLRAAIALEEAGVPYTARLLNLRALEHRDPAYLALNPAGKVPTLVD
NTSVPARIINQSNAIIQFADTSAPGRLAPAQLGSERDRVFDRYFFFVTDVIAPSHAAFFL
RQTGLDDAAAKIERLVIEQLVYSESFLTDAFMAGDHFSMADISAFTIAASVRDKLNWATL
PRLSRWFNAVDARPAVQRGIRAFEKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory