Comparing Pf6N2E2_993 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_993 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 93% coverage: 4:471/501 of query aligns to 2:471/501 of P04983
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
30% identity, 47% coverage: 1:233/501 of query aligns to 1:232/240 of 1ji0A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 45% coverage: 6:232/501 of query aligns to 2:236/241 of 4u00A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
29% identity, 42% coverage: 7:217/501 of query aligns to 7:220/375 of 2d62A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 43% coverage: 3:217/501 of query aligns to 1:227/254 of 1g6hA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
25% identity, 42% coverage: 6:216/501 of query aligns to 1:212/240 of 4ymuJ
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 43% coverage: 3:217/501 of query aligns to 1:227/253 of 1g9xB
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 42% coverage: 5:216/501 of query aligns to 2:214/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 42% coverage: 5:216/501 of query aligns to 2:214/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 42% coverage: 5:216/501 of query aligns to 2:214/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 42% coverage: 5:216/501 of query aligns to 2:214/242 of 2oljA
1g291 Malk (see paper)
27% identity, 42% coverage: 7:216/501 of query aligns to 4:216/372 of 1g291
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
29% identity, 43% coverage: 14:226/501 of query aligns to 34:257/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
29% identity, 43% coverage: 14:226/501 of query aligns to 34:257/382 of 7aheC
Sites not aligning to the query:
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
29% identity, 43% coverage: 5:219/501 of query aligns to 2:217/223 of 2pclA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
28% identity, 48% coverage: 4:241/501 of query aligns to 2:231/285 of 4yerA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 43% coverage: 12:227/501 of query aligns to 11:228/343 of P30750
Sites not aligning to the query:
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
31% identity, 40% coverage: 6:203/501 of query aligns to 2:201/220 of 8tzjA
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
31% identity, 41% coverage: 14:217/501 of query aligns to 9:214/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
31% identity, 41% coverage: 14:217/501 of query aligns to 9:214/219 of 8w6iD
>Pf6N2E2_993 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_993
MQSQKIVQVTGLHKTYGGITALKSIDFELNAGEIHGLCGENGAGKSTLVKILGGLVQPTE
GQILFDGAVLRPGRRTDPSCISIVHQELSIIPALSVLDNVLMGNAQVGRLYLRGRFKNDV
RRQLDSIGLSHVTLDQSASELSLAERQLVEISRCVLHGAKVLILDEPTATLAESEIARVF
TAVRWLRDQGTTVVFISHRLNEVFDLTDRITIFRSGERVLTAPTSEMTTESLVLAMVGHE
VERRSTLDAINPHAHLIRLKLDRFGVPNACQSLDLEVPAGEILGVVGQLGSGADRLIEAI
AGVRSHTGNLSIDGQQVDIQSPRKAISQGIAYVPEDRAGKGVFLEANIGQNSTASILFQF
SRFGRLERSQERDAALDLMKRFTIDTTRIGSKVSSLSGGNQQKVAMAKAAAISPKILILN
EPTRGVDVGARAEIYAQLRSMAATGLTVIFFSTDFEEVLELADRVITVFRGETVNDRVIE
HCSMTSILMDILHGRGEEKIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory