Comparing Pf6N2E2_997 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_997 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5PXQ6 Hydroxyquinol 1,2-dioxygenase; 1,2-HQD; EC 1.13.11.37 from Nocardioides simplex (Arthrobacter simplex) (see paper)
54% identity, 99% coverage: 1:239/242 of query aligns to 52:290/293 of Q5PXQ6
1tmxA Crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e (see paper)
54% identity, 99% coverage: 1:239/242 of query aligns to 51:289/292 of 1tmxA
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
55% identity, 86% coverage: 1:208/242 of query aligns to 44:251/286 of 3n9tA
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
32% identity, 99% coverage: 1:239/242 of query aligns to 48:290/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
32% identity, 99% coverage: 1:239/242 of query aligns to 48:290/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
32% identity, 99% coverage: 1:239/242 of query aligns to 48:290/309 of 1dlmA
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
32% identity, 99% coverage: 1:239/242 of query aligns to 50:292/311 of P07773
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
36% identity, 71% coverage: 40:211/242 of query aligns to 66:236/256 of 3i51A
Sites not aligning to the query:
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
36% identity, 71% coverage: 40:211/242 of query aligns to 66:236/256 of 3i4yA
Sites not aligning to the query:
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
36% identity, 71% coverage: 40:211/242 of query aligns to 66:236/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
36% identity, 71% coverage: 40:211/242 of query aligns to 66:236/256 of 3hjsA
Sites not aligning to the query:
3hjqA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol (see paper)
36% identity, 71% coverage: 40:211/242 of query aligns to 66:236/256 of 3hjqA
Sites not aligning to the query:
3hhyA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol (see paper)
36% identity, 71% coverage: 40:211/242 of query aligns to 66:236/256 of 3hhyA
Sites not aligning to the query:
3hhxA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
36% identity, 71% coverage: 40:211/242 of query aligns to 66:236/256 of 3hhxA
Sites not aligning to the query:
3hj8A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol (see paper)
36% identity, 71% coverage: 40:211/242 of query aligns to 67:237/257 of 3hj8A
Sites not aligning to the query:
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
36% identity, 71% coverage: 40:211/242 of query aligns to 68:238/258 of 3hgiA
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
32% identity, 99% coverage: 1:239/242 of query aligns to 49:289/310 of 5umhB
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
32% identity, 100% coverage: 1:242/242 of query aligns to 48:291/309 of 2azqA
2boyA Crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp (see paper)
34% identity, 71% coverage: 52:222/242 of query aligns to 69:241/253 of 2boyA
Sites not aligning to the query:
5vxtB Crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
35% identity, 79% coverage: 49:239/242 of query aligns to 100:292/312 of 5vxtB
>Pf6N2E2_997 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_997
LTEEEWEKGIEFLTAIGHITTDKRQEFILLSDTLGLSTLVIAQNHKKPEGCTEATVFGPF
HVANAPRYDLGEDISGGLPGVPWFVKGTVTAKDGTPIPNATIEVWQADDAGFYDVQKPDM
GDYHGRAVIQADANGHYYFRTIVPECYPIPHDGPVGKMLEALNRHPWRPAHLHFMITAPG
YQRLVTHVFREGGDYLDSDAVFGVRSSLIADWVRHESGIDPYGNSIDSLYYTLDFDFILH
NT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory