SitesBLAST
Comparing PfGW456L13_1040 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1040 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
26% identity, 62% coverage: 155:409/413 of query aligns to 116:366/377 of Q5L2C2
- V180 (= V222) binding
- R309 (= R353) binding
- 334:340 (vs. 377:383, 29% identical) binding
- R336 (≠ A379) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 62% coverage: 155:409/413 of query aligns to 115:364/368 of 4yshB
- active site: I262 (≠ V308), L283 (≠ I329), G305 (= G351), N335 (≠ L380), L338 (≠ T383)
- binding flavin-adenine dinucleotide: V178 (= V222), S206 (≠ A251), W209 (≠ R254), R307 (= R353), H332 (= H377), R334 (≠ A379), N335 (≠ L380), G336 (= G381), I337 (≠ F382), L338 (≠ T383)
- binding glycine: G249 (≠ R295), Y251 (≠ I297), Y251 (≠ I297), A264 (= A310), R307 (= R353), R334 (≠ A379), R334 (≠ A379)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 62% coverage: 155:409/413 of query aligns to 115:364/370 of 4yshA
- active site: I262 (≠ V308), L283 (≠ I329), G305 (= G351), N335 (≠ L380), L338 (≠ T383)
- binding flavin-adenine dinucleotide: V178 (= V222), S206 (≠ A251), G207 (= G252), W209 (≠ R254), R307 (= R353), H332 (= H377), R334 (≠ A379), N335 (≠ L380), G336 (= G381), I337 (≠ F382)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
24% identity, 95% coverage: 5:396/413 of query aligns to 4:344/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I8), G8 (= G9), G10 (= G11), V11 (= V12), I12 (= I13), V30 (= V31), E31 (= E32), K32 (≠ R34), E38 (= E40), A39 (≠ T41), S40 (= S42), A43 (≠ N45), G45 (= G47), L46 (≠ Q48), V171 (= V222), G200 (≠ A251), G201 (= G252), W203 (≠ R254), G298 (= G351), R300 (= R353), P301 (= P354), Y326 (≠ G378), R327 (≠ A379), N328 (≠ L380), G329 (= G381), I330 (≠ F382)
6j39A Crystal structure of cmis2 with inhibitor (see paper)
26% identity, 69% coverage: 110:396/413 of query aligns to 58:351/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ V288), Y252 (≠ I297), Y267 (≠ V312), R308 (= R353), R334 (≠ A379), I335 (≠ L380)
- binding flavin-adenine dinucleotide: A174 (≠ R213), A203 (= A251), W206 (vs. gap), I228 (≠ S274), Y252 (≠ I297), R308 (= R353), S333 (≠ G378), R334 (≠ A379), I335 (≠ L380), G336 (= G381), V337 (≠ F382), Q338 (≠ T383)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
26% identity, 69% coverage: 110:396/413 of query aligns to 58:351/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (≠ R213), A203 (= A251), W206 (vs. gap), G226 (= G272), G306 (= G351), R308 (= R353), S333 (≠ G378), R334 (≠ A379), I335 (≠ L380), G336 (= G381), V337 (≠ F382), Q338 (≠ T383)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
30% identity, 29% coverage: 162:281/413 of query aligns to 112:232/827 of 1pj7A
Sites not aligning to the query:
- active site: 256, 549
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 256, 331, 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
30% identity, 29% coverage: 162:281/413 of query aligns to 113:233/828 of 1pj6A
Sites not aligning to the query:
- active site: 257, 550
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 257, 331, 332, 358, 359, 360, 361
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
30% identity, 29% coverage: 162:281/413 of query aligns to 115:235/830 of Q9AGP8
- V174 (= V222) binding
- H225 (≠ K271) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
30% identity, 29% coverage: 162:281/413 of query aligns to 112:232/827 of 3gsiA
Sites not aligning to the query:
- active site: 256, 549
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
23% identity, 56% coverage: 166:396/413 of query aligns to 137:372/405 of P40875
- C146 (≠ E175) mutation to S: No change in activity.
- H173 (≠ C197) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ G199) mutation to A: No effect on FMN binding and activity.
- C195 (= C214) mutation to S: No change in activity.
- C351 (≠ L375) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
24% identity, 56% coverage: 166:396/413 of query aligns to 136:371/402 of 1vrqB
- active site: G326 (= G351), K358 (≠ T383)
- binding n,n-dimethylglycine: K358 (≠ T383)
- binding flavin-adenine dinucleotide: V196 (vs. gap), A224 (≠ I249), G225 (≠ A250), H228 (= H253), L247 (= L270), G353 (= G378), T354 (≠ A379), G355 (≠ L380), G356 (= G381), F357 (= F382), K358 (≠ T383)
- binding flavin mononucleotide: H172 (≠ C197), V251 (vs. gap), E279 (≠ Q305), R322 (≠ V347), W324 (= W349)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
24% identity, 56% coverage: 166:396/413 of query aligns to 137:372/405 of Q50LF2
- K172 (≠ D196) mutation to A: Retains 39% of wild-type activity.; mutation to D: Retains 32% of wild-type activity.; mutation to R: Retains 58% of wild-type activity.
- H173 (≠ C197) modified: Tele-8alpha-FMN histidine
- V197 (vs. gap) binding
- H270 (≠ R295) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ I297) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G378) binding
- G357 (= G381) binding
- K359 (≠ T383) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
24% identity, 56% coverage: 166:396/413 of query aligns to 136:371/404 of 3ad8B
- active site: G326 (= G351), K358 (≠ T383)
- binding flavin-adenine dinucleotide: V196 (vs. gap), G225 (≠ A250), A226 (= A251), H228 (= H253), L247 (= L270), G353 (= G378), T354 (≠ A379), G355 (≠ L380), G356 (= G381), F357 (= F382), K358 (≠ T383)
- binding flavin mononucleotide: H172 (≠ C197), V251 (vs. gap), E279 (≠ Q305), R322 (≠ V347), W324 (= W349)
- binding pyrrole-2-carboxylate: M264 (≠ I290), Y271 (≠ I297), T354 (≠ A379), K358 (≠ T383)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
24% identity, 56% coverage: 166:396/413 of query aligns to 136:371/404 of 3ad7B
- active site: G326 (= G351), K358 (≠ T383)
- binding flavin-adenine dinucleotide: V196 (vs. gap), G225 (≠ A250), A226 (= A251), H228 (= H253), L247 (= L270), G353 (= G378), T354 (≠ A379), G355 (≠ L380), G356 (= G381), F357 (= F382), K358 (≠ T383)
- binding flavin mononucleotide: H172 (≠ C197), V251 (vs. gap), K277 (≠ G303), E279 (≠ Q305), R322 (≠ V347), W324 (= W349)
- binding [methylthio]acetate: M264 (≠ I290), Y271 (≠ I297), T354 (≠ A379), K358 (≠ T383)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding [methylthio]acetate: 67, 69, 402
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
23% identity, 56% coverage: 166:396/413 of query aligns to 135:370/403 of 2gagB
- binding flavin-adenine dinucleotide: V195 (vs. gap), G224 (≠ A250), A225 (= A251), H227 (= H253), L231 (= L257), L246 (= L270), G352 (= G378), T353 (≠ A379), G354 (≠ L380), G355 (= G381), F356 (= F382), K357 (≠ T383)
- binding flavin mononucleotide: H171 (≠ C197), V250 (vs. gap), E278 (≠ Q305), R321 (≠ V347), W323 (= W349)
- binding 2-furoic acid: M263 (≠ I290), Y270 (≠ I297), K357 (≠ T383)
- binding sulfite ion: K170 (≠ D196), K276 (≠ G303)
Sites not aligning to the query:
- active site: 61, 64, 65
- binding flavin-adenine dinucleotide: 26, 28, 29, 30, 51, 52, 58, 59, 60, 62, 63, 64, 66
- binding flavin mononucleotide: 61, 62
- binding 2-furoic acid: 64, 66, 68, 401
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
56% identity, 10% coverage: 5:47/413 of query aligns to 6:48/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G9), G12 (= G11), I14 (= I13), E33 (= E32), K34 (≠ A33), E41 (= E40), T42 (= T41), S43 (= S42), A45 (= A44), N46 (= N45), S47 (≠ G46)
- binding sn-glycerol-3-phosphate: S47 (≠ G46)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 49, 51, 176, 177, 209, 210, 212, 234, 319, 320, 346, 347, 348, 349, 350, 351, 352
- binding sn-glycerol-3-phosphate: 51, 258, 259, 320, 348
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
56% identity, 10% coverage: 5:47/413 of query aligns to 6:48/384 of P75063
Sites not aligning to the query:
- 47:49 binding
- 177 binding
- 346:347 binding
- 352 binding
Query Sequence
>PfGW456L13_1040 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1040
MAQRVCIIGGGVIGLATAYALVRDGFEVTVVEARDSLGSETSFANGGQLSYRYVAPLADA
GVPLQAIGWMLRGDSPLKLRPRFDPAQWRWMASFLGACRRSVNRENAAHLLRLALFSQDT
LKSWREDDGLAGFQWRRNGKLVTFRQNSSFEHARQGLADPQQQQVLSPAECAQLEPALID
APFVGAIYTPDEEVGDCHGFCQQLAARLQASGRCEFRLGQAVTGIRHSNGSVNAIELGGQ
LLSVDQLVIAAGHRSPLLALPGLQLPLYPLKGYSLTVPIGAGHRAPDVSITDYDRKIVYA
RIGKQLRVAAMVDIVGFDPALDPKRLALIKRQARDTFPNAGAYDEAVEWAGMRPATPSGV
PLLGATAYRNLWLNLGHGALGFTLACGSGRLLSELIGERRLSIDLQGFSHRAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory