Comparing PfGW456L13_1042 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1042 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vhaA Debp (see paper)
53% identity, 90% coverage: 24:294/300 of query aligns to 1:271/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
53% identity, 90% coverage: 24:294/300 of query aligns to 2:272/278 of 2ia4B
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
52% identity, 81% coverage: 29:272/300 of query aligns to 5:247/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
32% identity, 80% coverage: 30:268/300 of query aligns to 6:234/243 of 5eyfB
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
32% identity, 73% coverage: 49:268/300 of query aligns to 16:223/225 of 4zv2A
Sites not aligning to the query:
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
32% identity, 73% coverage: 49:268/300 of query aligns to 16:225/226 of 4zv1A
Sites not aligning to the query:
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
30% identity, 80% coverage: 29:269/300 of query aligns to 2:229/229 of 5t0wA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
26% identity, 85% coverage: 21:274/300 of query aligns to 36:282/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
26% identity, 85% coverage: 21:274/300 of query aligns to 35:281/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
26% identity, 85% coverage: 21:274/300 of query aligns to 35:281/287 of 6h1uA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
28% identity, 80% coverage: 28:266/300 of query aligns to 2:229/247 of 2yjpA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
29% identity, 80% coverage: 30:270/300 of query aligns to 3:229/229 of 6svfA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
27% identity, 80% coverage: 28:267/300 of query aligns to 1:229/231 of 2v25A
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
26% identity, 82% coverage: 31:275/300 of query aligns to 7:246/246 of 4ohnA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
28% identity, 77% coverage: 39:270/300 of query aligns to 3:224/224 of 4ymxA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
26% identity, 82% coverage: 29:275/300 of query aligns to 5:237/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
26% identity, 82% coverage: 29:275/300 of query aligns to 9:241/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
26% identity, 82% coverage: 29:275/300 of query aligns to 9:241/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
26% identity, 82% coverage: 29:275/300 of query aligns to 9:241/241 of 3vvdA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
24% identity, 78% coverage: 35:268/300 of query aligns to 4:227/228 of 2y7iA
>PfGW456L13_1042 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1042
MQKNTLLACTLGLLLGSQVQANEAPLTGTLSKIASANSITLGYRDASVPFSYVGDHSGKP
MGYSVDLAGKIVERIQQQLALPDLKVKYNLVTSQTRIPLVQNGTVDLECGSTGVTAERQK
QVAFSYGFIYVKGQLLTAKDSGIKNFADLRGKNVVTTAGTTNERFLKSYNVDHKIDMFVI
SAKDHGEAFQMLQSGRAAAFYMDDALLYGERAKANDPHKWVVVGEEQSREIYSCMVRKDD
PQFLALVNGALADLYSSGEINGIYKRWFEQPIPPKGLNLEFPMTSELKAIIAKPVSDPVQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory