Comparing PfGW456L13_1087 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1087 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
31% identity, 50% coverage: 132:271/281 of query aligns to 60:199/506 of A0A0H2ZQB9
Sites not aligning to the query:
B5Z7I3 Ergothioneine transport permease/ergothioneine binding protein EgtU from Helicobacter pylori (strain G27) (see paper)
27% identity, 60% coverage: 103:270/281 of query aligns to 69:236/553 of B5Z7I3
Sites not aligning to the query:
>PfGW456L13_1087 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1087
MLIDQKIPLGQYIAGFVEWLTQHGANTFDAIAVSLETMIHGVTFALTWFNPLVLIGVIAL
LAHFIQRKWGLTAFVVASFLLILNLGYWQETMETLAQVLFATLVCVIIGVPLGIVAAHKP
MFYTLMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVP
EELMDAGKAFGCSRRQLLSRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPV
VNALNTADIALGFEAGLAIVLLAIMLDRICKQPDAKVGGDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory