Comparing PfGW456L13_1398 Omega-amino acid--pyruvate aminotransferase (EC 2.6.1.18) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7q9xAAA Probable aminotransferase
56% identity, 98% coverage: 5:451/456 of query aligns to 1:447/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
56% identity, 98% coverage: 5:451/456 of query aligns to 1:447/455 of 4a6tC
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
56% identity, 98% coverage: 7:451/456 of query aligns to 2:446/453 of 6s4gA
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
53% identity, 98% coverage: 7:452/456 of query aligns to 3:448/450 of 6gwiB
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
52% identity, 98% coverage: 7:454/456 of query aligns to 2:443/443 of 7qx0B
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
57% identity, 92% coverage: 34:451/456 of query aligns to 2:419/427 of 4ba5A
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
56% identity, 92% coverage: 34:451/456 of query aligns to 1:415/423 of 4a6rA
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
53% identity, 92% coverage: 34:454/456 of query aligns to 2:422/422 of 7qx3A
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
44% identity, 97% coverage: 6:447/456 of query aligns to 2:445/454 of 7ypmA
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
48% identity, 91% coverage: 34:450/456 of query aligns to 1:380/384 of 5ti8B
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
43% identity, 97% coverage: 6:449/456 of query aligns to 2:447/455 of 7ypnD
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
41% identity, 96% coverage: 12:447/456 of query aligns to 10:444/448 of 6io1B
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
40% identity, 98% coverage: 6:452/456 of query aligns to 5:459/460 of 5kr6B
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
40% identity, 91% coverage: 34:450/456 of query aligns to 31:453/455 of 5kr5A
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
40% identity, 92% coverage: 34:452/456 of query aligns to 34:456/458 of 5kr3A
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
37% identity, 97% coverage: 14:454/456 of query aligns to 7:450/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
37% identity, 97% coverage: 14:454/456 of query aligns to 7:450/451 of 6g4eA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
37% identity, 97% coverage: 14:454/456 of query aligns to 7:450/453 of 6g4dB
5ghgB Transaminase w58l with smba
37% identity, 94% coverage: 11:440/456 of query aligns to 5:418/433 of 5ghgB
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
37% identity, 93% coverage: 29:452/456 of query aligns to 23:453/459 of D6R3B6
>PfGW456L13_1398 Omega-amino acid--pyruvate aminotransferase (EC 2.6.1.18)
MTTPRDTRDYQAADAAHHIHAFVDQKALNDEGPRVMVRGERLHLWDNDGRRYLDGMSGLW
CTNLGYGRKDLAAAASRQLEQLPYYNMFFHTTHPQVIELSELLFSLLPAHYSHAIYTNSG
SEANEVLIRTVRRYWQVLGKPEKKIMIGRWNGYHGSTLAATALGGMKFMHEMGGMIPDIE
HIDEPYFFAHEGNLTPAEFGLRAAQQLEAKILELGADKVAGFIAEPFQGAGGMIFPPESY
WPEIQRICRKYDVLLCADEVIGGFGRTGEWFAHEYFGFEPDTLSIAKGLTSGYIPMGGLI
LSKKMASVLVEQGGVFAHGLTYSGHPVAAAVAIANLKALRDEGVVTRVKDDIGPYLQQCL
REVFGKHPLVGDIQGTGMVAALQLAEDKTSRKRFANENDIAWRCRTIGFEEGVIIRSTLG
RMIMAPALIASREEIDELIAKTLKAVDRTAQEYGRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory