SitesBLAST
Comparing PfGW456L13_1401 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1401 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8w9mC Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
41% identity, 89% coverage: 24:270/277 of query aligns to 3:253/256 of 8w9mC
- binding adenosine-5'-triphosphate: F12 (≠ Y33), Y20 (≠ F41), S42 (= S63), G43 (= G64), G45 (= G66), K46 (= K67), S47 (= S68), T48 (≠ S69), Q83 (= Q104), K132 (≠ N151), E136 (≠ Q155), S138 (= S157), G140 (= G159), H195 (= H214)
- binding magnesium ion: S47 (= S68), Q83 (= Q104)
8wm7C Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
42% identity, 89% coverage: 24:270/277 of query aligns to 3:253/658 of 8wm7C
8wm7D Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
45% identity, 84% coverage: 24:255/277 of query aligns to 5:238/257 of 8wm7D
8w9mD Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
45% identity, 84% coverage: 24:255/277 of query aligns to 3:236/256 of 8w9mD
- binding adenosine-5'-triphosphate: Y12 (= Y33), H40 (≠ P62), S41 (= S63), G42 (= G64), G44 (= G66), K45 (= K67), S46 (= S68), T47 (≠ S69), Q82 (= Q104), Q135 (= Q155), S137 (= S157), G139 (= G159), M140 (= M160), H194 (= H214)
- binding magnesium ion: S46 (= S68), Q82 (= Q104)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
42% identity, 73% coverage: 39:239/277 of query aligns to 37:244/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
42% identity, 73% coverage: 39:239/277 of query aligns to 37:244/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
42% identity, 73% coverage: 39:239/277 of query aligns to 37:244/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ F41), S61 (= S63), G62 (= G64), G64 (= G66), K65 (= K67), S66 (= S68), T67 (≠ S69), Q111 (= Q104), K161 (= K154), Q162 (= Q155), S164 (= S157), G166 (= G159), M167 (= M160), Q188 (≠ E181), H221 (= H214)
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
44% identity, 77% coverage: 26:239/277 of query aligns to 5:215/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y33), S38 (= S63), G39 (= G64), G41 (= G66), K42 (= K67), S43 (= S68), Q82 (= Q104), Q133 (= Q155), G136 (= G158), G137 (= G159), Q138 (≠ M160), H192 (= H214)
- binding magnesium ion: S43 (= S68), Q82 (= Q104)
8hprD Lpqy-sugabc in state 4 (see paper)
44% identity, 77% coverage: 26:239/277 of query aligns to 5:215/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y33), S38 (= S63), C40 (= C65), G41 (= G66), K42 (= K67), S43 (= S68), T44 (≠ S69), Q82 (= Q104), R129 (≠ N151), Q133 (= Q155), S135 (= S157), G136 (= G158), G137 (= G159), Q159 (≠ E181), H192 (= H214)
- binding magnesium ion: S43 (= S68), Q82 (= Q104)
8hplC Lpqy-sugabc in state 1 (see paper)
43% identity, 77% coverage: 26:239/277 of query aligns to 5:213/384 of 8hplC
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 82% coverage: 26:253/277 of query aligns to 6:232/393 of P9WQI3
- H193 (= H214) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
1g291 Malk (see paper)
42% identity, 69% coverage: 39:229/277 of query aligns to 14:213/372 of 1g291
- binding magnesium ion: D69 (≠ G94), E71 (≠ G96), K72 (≠ A97), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S63), G39 (= G64), C40 (= C65), G41 (= G66), K42 (= K67), T43 (≠ S68), T44 (≠ S69)
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
40% identity, 73% coverage: 39:239/277 of query aligns to 17:224/375 of 2d62A
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
40% identity, 73% coverage: 39:239/277 of query aligns to 13:214/374 of 2awnB
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
40% identity, 73% coverage: 39:239/277 of query aligns to 13:214/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S63), G38 (= G64), C39 (= C65), G40 (= G66), K41 (= K67), S42 (= S68), T43 (≠ S69), Q81 (= Q104), R128 (≠ N151), A132 (≠ Q155), S134 (= S157), G136 (= G159), Q137 (≠ M160), E158 (= E181), H191 (= H214)
- binding magnesium ion: S42 (= S68), Q81 (= Q104)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
40% identity, 73% coverage: 39:239/277 of query aligns to 13:214/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G64), C39 (= C65), G40 (= G66), K41 (= K67), S42 (= S68), T43 (≠ S69), R128 (≠ N151), S134 (= S157), Q137 (≠ M160)
- binding beryllium trifluoride ion: S37 (= S63), G38 (= G64), K41 (= K67), Q81 (= Q104), S134 (= S157), G136 (= G159), H191 (= H214)
- binding magnesium ion: S42 (= S68), Q81 (= Q104)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
40% identity, 73% coverage: 39:239/277 of query aligns to 13:214/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (≠ A43), G38 (= G64), C39 (= C65), G40 (= G66), K41 (= K67), S42 (= S68), T43 (≠ S69), R128 (≠ N151), A132 (≠ Q155), S134 (= S157), Q137 (≠ M160)
- binding tetrafluoroaluminate ion: S37 (= S63), G38 (= G64), K41 (= K67), Q81 (= Q104), S134 (= S157), G135 (= G158), G136 (= G159), E158 (= E181), H191 (= H214)
- binding magnesium ion: S42 (= S68), Q81 (= Q104)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
40% identity, 73% coverage: 39:239/277 of query aligns to 13:214/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (≠ A43), G38 (= G64), C39 (= C65), G40 (= G66), K41 (= K67), S42 (= S68), T43 (≠ S69), R128 (≠ N151), A132 (≠ Q155), S134 (= S157), Q137 (≠ M160)
- binding magnesium ion: S42 (= S68), Q81 (= Q104)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
40% identity, 73% coverage: 39:239/277 of query aligns to 14:215/371 of P68187
- A85 (≠ T107) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ R132) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V140) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V143) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (vs. gap) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ S146) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G159) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D180) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
40% identity, 73% coverage: 39:239/277 of query aligns to 11:212/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S63), G36 (= G64), C37 (= C65), G38 (= G66), K39 (= K67), S40 (= S68), T41 (≠ S69), R126 (≠ N151), A130 (≠ Q155), S132 (= S157), G134 (= G159), Q135 (≠ M160)
Sites not aligning to the query:
Query Sequence
>PfGW456L13_1401 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1401
MGSVTAATHRFVAPQAAPVNAPRLKVDKVSLSYKKPDGGTFTALQGVSFEVPDQQFAVLV
GPSGCGKSSLLYLTAGLAEPTSGEIYVGGQQVEGPGADRGMVFQSYTLFPWLTVRQNVEF
GLKRRGMPAAQRKDIVDYYVNEVGLSGFADNYAKQLSGGMMQRVAIARALANDPQILLMD
EPFGALDSQTRLQMQQLLLRVWGNSKKTVLFVTHDIDEAILLGDRVYVMGARPGRIKQIL
DVPIERPRNLDMAMERSFIEMKREIFGLLHDDLEEVH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory