SitesBLAST
Comparing PfGW456L13_1449 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1449 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
27% identity, 93% coverage: 1:390/420 of query aligns to 21:420/425 of O59010
- S65 (≠ V39) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A251) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 251:253) binding
- M311 (≠ L286) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ F289) binding
- V355 (≠ I330) binding
- D394 (≠ G364) binding
- M395 (≠ I365) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R367) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N371) binding
- D405 (≠ N375) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 92% coverage: 1:386/420 of query aligns to 12:407/407 of 2nwwA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
26% identity, 94% coverage: 1:393/420 of query aligns to 12:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A251), S265 (= S253), M299 (≠ L286), T302 (≠ F289), T340 (≠ A327), G342 (= G329), V343 (≠ I330), G347 (≠ A334), D383 (≠ G364), R386 (= R367), T387 (≠ A368), N390 (= N371)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E12), V212 (≠ L200), A216 (≠ G204)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
27% identity, 92% coverage: 1:386/420 of query aligns to 18:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G43), V83 (= V61), I157 (≠ L143), Y164 (≠ L150), K193 (≠ R171), T305 (≠ S283), I306 (≠ F284), I347 (≠ K325)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: M199 (≠ V177), S275 (= S253), T311 (≠ F289), G356 (≠ A334), L384 (= L357), D391 (≠ G364), R394 (= R367)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
27% identity, 92% coverage: 1:386/420 of query aligns to 13:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
27% identity, 92% coverage: 1:386/420 of query aligns to 13:408/408 of 6bauA
- binding cysteine: S270 (= S253), M303 (≠ L286), T306 (≠ F289), A345 (≠ H328), G346 (= G329), V347 (≠ I330), G351 (≠ A334), D386 (≠ G364), C389 (≠ R367), T390 (≠ A368), N393 (= N371)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
27% identity, 92% coverage: 1:386/420 of query aligns to 21:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L20), F46 (≠ L20), P75 (≠ D49), L91 (≠ V66), F95 (≠ I70), L130 (≠ T113), I133 (≠ F116), I159 (≠ V142), Y167 (≠ L150), K196 (≠ R171), G200 (≠ M175), I207 (= I182), F210 (= F185), L250 (≠ V225), I262 (≠ L237), M269 (≠ L244), T334 (≠ A309), V335 (≠ M310), G336 (≠ T311), T340 (= T315), L343 (= L318), M399 (≠ L369)
- binding aspartic acid: S277 (= S252), S278 (= S253), T314 (≠ F289), G354 (= G329), A358 (≠ S333), G359 (≠ A334), D394 (≠ G364), R397 (= R367), T398 (≠ A368)
- binding sodium ion: Y89 (≠ F64), T92 (≠ L67), S93 (≠ T68), G306 (= G281), T308 (≠ S283), N310 (= N285), N310 (= N285), M311 (≠ L286), D312 (= D287), S349 (= S324), I350 (≠ K325), T352 (≠ A327), N401 (= N371), V402 (≠ L372), D405 (≠ N375)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
26% identity, 94% coverage: 1:393/420 of query aligns to 17:421/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
26% identity, 94% coverage: 1:393/420 of query aligns to 19:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
26% identity, 94% coverage: 1:393/420 of query aligns to 19:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ A251), S275 (= S252), S276 (= S253), T313 (≠ F289), G353 (= G329), V354 (≠ I330), A357 (≠ S333), G358 (≠ A334), D394 (≠ G364), R397 (= R367), T398 (≠ A368)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R171), G198 (≠ M175), Y202 (≠ L179)
- binding sodium ion: Y87 (≠ F64), T90 (≠ L67), S91 (≠ T68), S276 (= S253), G305 (= G281), A306 (≠ Y282), T307 (≠ S283), N309 (= N285), N309 (= N285), M310 (≠ L286), D311 (= D287), S348 (= S324), I349 (≠ K325), G350 (= G326), T351 (≠ A327), N401 (= N371), V402 (≠ L372), D405 (≠ N375)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
26% identity, 94% coverage: 1:393/420 of query aligns to 16:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ R171), G195 (≠ M175), R282 (= R262)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A251), S272 (= S252), S273 (= S253), M307 (≠ L286), T310 (≠ F289), G353 (= G332), A354 (≠ S333), R394 (= R367), T395 (≠ A368)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
26% identity, 92% coverage: 1:386/420 of query aligns to 13:396/396 of 6bmiA
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
25% identity, 100% coverage: 1:418/420 of query aligns to 59:542/543 of P56564
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (≠ R106) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 97% coverage: 1:407/420 of query aligns to 59:524/542 of P43003
- S363 (≠ A251) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ ASS 251:253) binding
- T396 (≠ S283) binding
- T402 (≠ F289) binding
- IPQAG 443:447 (≠ IPGSA 330:334) binding
- D476 (≠ G364) binding
- R477 (≠ I365) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N371) binding
- Y523 (≠ F406) mutation to F: No effect on activity.
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
26% identity, 94% coverage: 3:395/420 of query aligns to 33:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V53), G89 (= G54), G92 (= G57), A95 (≠ S60), V96 (= V61), Y99 (≠ F64), M163 (≠ V142), F167 (≠ S146), F293 (≠ L276), V297 (≠ T280)
- binding aspartic acid: S268 (= S252), S269 (= S253), T306 (≠ F289), G346 (= G329), I347 (= I330), A350 (≠ S333), G351 (≠ A334), D380 (≠ G364), R383 (= R367), T384 (≠ A368)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
27% identity, 89% coverage: 1:375/420 of query aligns to 20:403/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S252), S281 (= S253), T318 (≠ F289), G363 (≠ A334), M367 (≠ L338), V385 (≠ L357), D388 (= D360), R395 (= R367), T396 (≠ A368)
- binding dodecyl beta-D-glucopyranoside: I20 (≠ V1), W389 (= W361)
- binding cholesterol hemisuccinate: R80 (= R55), R84 (≠ K59), I95 (= I70), I252 (= I221)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
27% identity, 89% coverage: 1:375/420 of query aligns to 19:404/425 of 7xr4A
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
27% identity, 89% coverage: 1:375/420 of query aligns to 12:388/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ V39), L58 (≠ V40), L65 (≠ A47), V339 (≠ K325), G340 (= G326), S343 (≠ G329), I344 (= I330)
- binding cholesterol: W188 (≠ R178), I227 (vs. gap), F250 (≠ W234), W257 (≠ L244), M379 (≠ G366), S382 (≠ L369)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S253), M300 (≠ L286), T303 (≠ F289), Y306 (= Y292), G348 (≠ A334), L349 (= L335), M352 (≠ L338), I366 (≠ L353), L369 (≠ V356), V370 (≠ L357), D373 (= D360), D377 (≠ G364), R380 (= R367), T381 (≠ A368), N384 (= N371)
Sites not aligning to the query:
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
26% identity, 93% coverage: 3:394/420 of query aligns to 25:397/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I44), S80 (≠ V53), G81 (= G54), G84 (= G57), Y91 (≠ F64), M156 (≠ V142), F160 (≠ S146), F286 (≠ L276), V290 (≠ T280)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V36), I148 (= I134), S262 (= S253), S263 (≠ D254), A292 (≠ Y282), T293 (≠ S283), M296 (≠ L286), T299 (≠ F289), G329 (= G326), A336 (≠ S333), G337 (≠ A334), D366 (≠ G364), R369 (= R367), N373 (= N371)
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
25% identity, 99% coverage: 1:417/420 of query aligns to 55:541/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
Query Sequence
>PfGW456L13_1449 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1449
VLGIVCGLTLPEYSAQLKPLGDGFIKLIKMLIGLIVFCVVVSGISGAGDLKKVGRIGLKS
VIYFEVLTTIALVIGLVFAFSTGIGSGANIHLEQLSAADMGDIAQRGQHMHTTTQFLMDL
IPTSVIGAFADNNILQVLLFSVLFGSALNLVGEAASGISRLINELSHVIFRIMGMIVRLA
PIGVFGAIAFTTSKYGLDSLQHLGSLVGLFYLTCVAFVALILGLVMRLSGLKMWPLLKYL
REELLIVMGTASSDAVLPQIMRKLEHLGIGSSTVGLVIPTGYSFNLDGFSIYLTLAIVFI
ANATGTPLAMTDLLTILLVSLITSKGAHGIPGSALVILAATLTAIPAIPVVGLVLVLAVD
WFMGIGRALTNLIGNCVATVAIARWEKDIDIQRANKVLSGQMGYTFQPKKPVAPAHQQEF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory