SitesBLAST
Comparing PfGW456L13_1712 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1712 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 62% coverage: 42:318/445 of query aligns to 56:315/444 of Q8NLB7
- D57 (= D43) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R96) mutation to A: Loss of transport activity.
- W309 (= W312) mutation to V: Loss of transport activity.
- D312 (= D315) mutation to A: Loss of transport activity.
- R313 (= R316) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
25% identity, 72% coverage: 86:406/445 of query aligns to 162:487/554 of O15245
- S189 (≠ C113) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A152) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ P172) mutation to F: Decreased TEA uptake.
- P283 (= P207) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (vs. gap) to G: in dbSNP:rs4646278
- P341 (≠ V256) to L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- R342 (≠ L257) to H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- Y361 (≠ F276) mutation to F: Decreased TEA uptake.
- Y376 (≠ R289) mutation to F: Decreased TEA uptake.
- G401 (= G318) to S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- M408 (≠ I325) to V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- M420 (= M337) natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- M440 (= M360) to I: in dbSNP:rs35956182
- V461 (= V379) to I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- G465 (= G383) to R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; mutation to A: No changes in MPP(+) uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 160 L → F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
24% identity, 73% coverage: 85:409/445 of query aligns to 160:489/532 of 8et8A
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: K213 (≠ G146), W216 (= W149), Q240 (= Q173), W353 (≠ L269), Y360 (≠ F276), F378 (≠ E290), S381 (≠ L293), E385 (≠ C297), C449 (≠ G368), S469 (= S385)
Sites not aligning to the query:
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
24% identity, 73% coverage: 85:409/445 of query aligns to 160:489/532 of 8et7A
Sites not aligning to the query:
Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
25% identity, 73% coverage: 85:409/445 of query aligns to 162:491/555 of Q9R0W2
- C451 (≠ A369) Involved in recognition of organic cations and participates in structural changes that occur during translocation of organic cations; mutation to M: Transport activity strongly reduced.
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
25% identity, 72% coverage: 86:406/445 of query aligns to 144:426/453 of 8sc2A
Sites not aligning to the query:
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
26% identity, 72% coverage: 86:406/445 of query aligns to 144:419/447 of 8sc6A
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
26% identity, 72% coverage: 86:406/445 of query aligns to 144:417/445 of 8sc3A
8et9A Cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium (see paper)
31% identity, 28% coverage: 85:207/445 of query aligns to 160:282/517 of 8et9A
Sites not aligning to the query:
Q9VCA2 Organic cation transporter protein from Drosophila melanogaster (Fruit fly) (see paper)
28% identity, 38% coverage: 85:251/445 of query aligns to 143:302/548 of Q9VCA2
Sites not aligning to the query:
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
29% identity, 28% coverage: 85:207/445 of query aligns to 162:284/556 of Q63089
- C179 (≠ T102) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ L143) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (≠ G144) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (≠ L145) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ G146) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (= G147) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ E148) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (= W149) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (≠ G150) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (≠ G151) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (≠ A152) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (≠ A153) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (≠ L154) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
- L224 (= L155) mutation to V: Decreased TEA and MPP(+) uptake.
- I225 (≠ A156) mutation to G: No change in TEA and MPP(+) uptake.
- T226 (= T157) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
- E227 (= E158) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
- F228 (≠ N159) mutation to I: No change in TEA and MPP(+) uptake.
- V229 (≠ A160) mutation to A: Decreased TEA and MPP(+) uptake.; mutation to L: Loss of TEA and MPP(+) uptake activity.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 155 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 286 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- 292 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- 296 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
- 322 C→S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- 328 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
- 358 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- 418 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- 437 C→S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- 451 C→M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- 470 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- 474 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- 475 D→E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; D→N: Decreased MPP(+) uptake.; D→R: Decreased MPP(+) uptake.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
Query Sequence
>PfGW456L13_1712 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1712
MTVRDNRMTTSTTYSDSTPAQPTNSATRVATASFIGTAIEFYDFYVYATAAALVIGPVFF
PQTSGTAQMLSAFLTFGIAFLARPLGSALFGHFGDRIGRKSTLVASLLLMGVCTTLIGVL
PGYDSIGAWAPILLCVLRFGQGLGLGGEWGGAALLATENAPKGKRAWFGMFPQLGPSIGF
LAANGLFLTLAVVLDDEQFRSWGWRIPFLLSAALVMVGLYVRLKLHETPVFANAMARQER
VKIPLFELFGQYWVPVLLGAGAMVVCYALFYISTVFSLSYGVATLGYSRETFLGLLCFAV
LFMAAATPLSAWASDRYGRKPVLIIGGVLAILSGFLMEPLLTQGSTWGVALFLCIELFLM
GVTFAPMGALLPELFPTHVRYTGASAAYNLGGIVGASAAPFFAQKLVAMGGLSYVGGYVS
AAAVLSLIAVLCLKETRHNDLNQVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory