SitesBLAST
Comparing PfGW456L13_1894 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1894 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
5dvjA Crystal structure of galactose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
70% identity, 94% coverage: 28:432/432 of query aligns to 1:396/396 of 5dvjA
- binding beta-D-galactopyranose: W10 (= W37), W11 (= W38), E16 (= E43), G42 (= G69), G43 (= G70), Q65 (= Q92), K67 (= K94), H118 (= H147), W225 (= W255), W245 (= W275), N276 (= N306), D278 (= D308), K314 (= K346), H354 (= H390)
5dviA High resolution crystal structure of glucose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
70% identity, 94% coverage: 28:432/432 of query aligns to 1:396/396 of 5dviA
- binding beta-D-glucopyranose: W10 (= W37), W11 (= W38), E16 (= E43), G42 (= G69), G43 (= G70), Q65 (= Q92), K67 (= K94), H118 (= H147), W225 (= W255), W245 (= W275), N276 (= N306), D278 (= D308), K314 (= K346), H354 (= H390)
4r2bA Crystal structure of sugar transporter oant_3817 from ochrobactrum anthropi, target efi-510528, with bound glucose
44% identity, 94% coverage: 27:432/432 of query aligns to 2:395/395 of 4r2bA
- binding alpha-D-glucopyranose: W12 (= W37), W13 (= W38), E18 (= E43), G44 (= G69), G45 (= G70), Q67 (= Q92), L69 (≠ K94), H120 (= H147), W226 (= W255), W246 (= W275), N277 (= N306), D279 (= D308), K314 (= K346), H354 (= H390)
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
27% identity, 82% coverage: 32:384/432 of query aligns to 3:346/392 of 2b3fA
- binding beta-D-galactopyranose: W8 (= W37), W9 (= W38), E13 (= E43), G41 (= G69), A42 (≠ G70), Q64 (= Q92), H66 (≠ K94), H119 (= H147), W224 (= W255), W244 (= W275), L276 (≠ N306), D278 (= D308), K312 (= K346)
Sites not aligning to the query:
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
27% identity, 82% coverage: 32:384/432 of query aligns to 3:346/392 of 2b3bC
- binding beta-D-glucopyranose: W8 (= W37), W9 (= W38), E13 (= E43), G41 (= G69), A42 (≠ G70), Q64 (= Q92), H66 (≠ K94), H119 (= H147), W224 (= W255), W244 (= W275), D278 (= D308), K312 (= K346)
Sites not aligning to the query:
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
27% identity, 82% coverage: 32:384/432 of query aligns to 3:346/392 of 2b3bA
- binding alpha-D-glucopyranose: W8 (= W37), W9 (= W38), E13 (= E43), G41 (= G69), A42 (≠ G70), Q64 (= Q92), H66 (≠ K94), H119 (= H147), W224 (= W255), W244 (= W275), D278 (= D308), K312 (= K346)
Sites not aligning to the query:
4c1tA Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. Lactis bl-04 in complex with arabinoxylotriose (see paper)
29% identity, 42% coverage: 95:275/432 of query aligns to 60:248/396 of 4c1tA
Sites not aligning to the query:
- binding alpha-L-arabinofuranose: 43, 44, 46, 47
- binding beta-D-xylopyranose: 10, 10, 11, 12, 13, 43, 43, 321, 355, 357
7ehqA Chitin oligosaccharide binding protein (see paper)
28% identity, 47% coverage: 78:278/432 of query aligns to 55:254/406 of 7ehqA
Sites not aligning to the query:
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
25% identity, 52% coverage: 80:303/432 of query aligns to 50:266/390 of 3oo6A
Sites not aligning to the query:
7c0kB Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) (see paper)
30% identity, 37% coverage: 25:184/432 of query aligns to 12:164/397 of 7c0kB
- binding carbonate ion: T26 (= T39), A114 (≠ T132), R116 (≠ K134), F117 (≠ Y135)
- binding [(1S,3R,3aR,6aS)-3-(2-azanyl-6-oxidanylidene-1H-purin-9-yl)-5,5-bis(oxidanyl)-1,3,3a,4,6,6a-hexahydrocyclopenta[c]furan-1-yl]methyl [(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-2-(hydroxymethyl)-4-oxidanyl-oxolan-3-yl] hydrogen phosphate: F25 (≠ W38), P30 (≠ E43), Y58 (≠ G71), R59 (≠ S72), F81 (≠ K94), N83 (≠ P96), S129 (≠ R148)
- binding 1,3-propandiol: E40 (≠ Q53), A44 (≠ D57)
- binding phosphite ion: L109 (≠ W121), N113 (≠ D131)
Sites not aligning to the query:
- binding carbonate ion: 226, 229, 354
- binding [(1S,3R,3aR,6aS)-3-(2-azanyl-6-oxidanylidene-1H-purin-9-yl)-5,5-bis(oxidanyl)-1,3,3a,4,6,6a-hexahydrocyclopenta[c]furan-1-yl]methyl [(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-2-(hydroxymethyl)-4-oxidanyl-oxolan-3-yl] hydrogen phosphate: 177, 226, 228, 229, 242, 244, 245, 248, 276, 277, 316, 359, 362, 363
- binding 1,3-propandiol: 300
7c0kA Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) (see paper)
30% identity, 37% coverage: 25:184/432 of query aligns to 11:163/396 of 7c0kA
- binding 2-hydroxy butane-1,4-diol: G26 (≠ S40), G27 (= G41)
- binding [(1S,3R,3aR,6aS)-3-(2-azanyl-6-oxidanylidene-1H-purin-9-yl)-5,5-bis(oxidanyl)-1,3,3a,4,6,6a-hexahydrocyclopenta[c]furan-1-yl]methyl [(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-2-(hydroxymethyl)-4-oxidanyl-oxolan-3-yl] hydrogen phosphate: F24 (≠ W38), P29 (≠ E43), Y57 (≠ G71), R58 (≠ S72), F80 (≠ K94), N82 (≠ P96), S128 (≠ R148)
- binding 1,3-propandiol: A113 (≠ T132)
- binding hypophosphite: N112 (≠ D131), A113 (≠ T132), R115 (≠ K134), F116 (≠ Y135), K136 (≠ P156), K140 (= K160)
Sites not aligning to the query:
- binding 2-hydroxy butane-1,4-diol: 250
- binding [(1S,3R,3aR,6aS)-3-(2-azanyl-6-oxidanylidene-1H-purin-9-yl)-5,5-bis(oxidanyl)-1,3,3a,4,6,6a-hexahydrocyclopenta[c]furan-1-yl]methyl [(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-2-(hydroxymethyl)-4-oxidanyl-oxolan-3-yl] hydrogen phosphate: 176, 225, 227, 228, 241, 243, 244, 247, 275, 276, 315, 358, 361, 362
- binding 1,3-propandiol: 311, 331, 338, 350, 351
7c0fA Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form i) (see paper)
30% identity, 37% coverage: 25:184/432 of query aligns to 10:162/395 of 7c0fA
- binding [(1S,3R,3aR,6aS)-3-(2-azanyl-6-oxidanylidene-1H-purin-9-yl)-5,5-bis(oxidanyl)-1,3,3a,4,6,6a-hexahydrocyclopenta[c]furan-1-yl]methyl [(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-2-(hydroxymethyl)-4-oxidanyl-oxolan-3-yl] hydrogen phosphate: F23 (≠ W38), P28 (≠ E43), Y56 (≠ G71), R57 (≠ S72), F79 (≠ K94), N81 (≠ P96), S127 (≠ R148)
- binding 1,3-propandiol: G104 (≠ A118)
- binding hypophosphite: T24 (= T39)
Sites not aligning to the query:
- binding [(1S,3R,3aR,6aS)-3-(2-azanyl-6-oxidanylidene-1H-purin-9-yl)-5,5-bis(oxidanyl)-1,3,3a,4,6,6a-hexahydrocyclopenta[c]furan-1-yl]methyl [(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-2-(hydroxymethyl)-4-oxidanyl-oxolan-3-yl] hydrogen phosphate: 175, 224, 226, 227, 240, 242, 243, 246, 274, 275, 314, 357, 360, 361
- binding 1,3-propandiol: 302, 318, 319, 320
- binding hypophosphite: 227
Query Sequence
>PfGW456L13_1894 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1894
MNAISRLATVISLASLSALPLSVLAAESKGSVEVVHWWTSGGEKAAVDVLKAQVEKDGFT
WKDGAVAGGGGSTAMTVLKSRAVAGNPPGVAQIKGPDIQEWGSTGLLSTDALKDVSKAEN
WDGLLSKKVSDTVKYEGDYVAVPVNIHRVNWLWINPEVFKKAGIEKAPTTLEEFYAAGDK
LKAAGFIALAHGGQPWQDSTVFEDVVLSVMGADGYKKALVDLDQKTLSGPEMTKSFAELK
KITGYMDPNRAGRDWNIAAADVISGKAGMQMMGDWAKSEWTAAKKIAGKDYQCVAFPGTE
KAFTYNIDSMAVFKLKADRKGDIAAQQDLAKVALGTDFQKVFSMNKGSIPVRNDMLNEMD
KLGFDECAQKSAKDFIADDKTGGLQPSMAHNMATSLAVQGAIFDVVTNFMNDKDADPAKA
SAQLASAVKAAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory