Comparing PfGW456L13_1920 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1920 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7yleA Rndmpx in complex with dmsp (see paper)
27% identity, 89% coverage: 27:325/337 of query aligns to 1:286/299 of 7yleA
Q5LT66 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
22% identity, 97% coverage: 1:327/337 of query aligns to 18:333/333 of Q5LT66
Sites not aligning to the query:
4xz6A Tmox in complex with tmao (see paper)
23% identity, 88% coverage: 30:327/337 of query aligns to 9:291/291 of 4xz6A
Q4FL33 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Pelagibacter ubique (strain HTCC1062) (see paper)
20% identity, 95% coverage: 1:321/337 of query aligns to 1:309/314 of Q4FL33
2rinA Abc-transporter choline binding protein in complex with acetylcholine (see paper)
23% identity, 91% coverage: 26:332/337 of query aligns to 1:273/288 of 2rinA
2regA Abc-transporter choline binding protein in complex with choline (see paper)
23% identity, 91% coverage: 26:332/337 of query aligns to 3:275/290 of 2regA
1r9qA Structure analysis of prox in complex with proline betaine (see paper)
23% identity, 70% coverage: 96:332/337 of query aligns to 76:308/309 of 1r9qA
Sites not aligning to the query:
P0AFM2 Glycine betaine/proline betaine-binding periplasmic protein; GBBP from Escherichia coli (strain K12) (see 2 papers)
23% identity, 70% coverage: 96:332/337 of query aligns to 97:329/330 of P0AFM2
Sites not aligning to the query:
>PfGW456L13_1920 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1920
MRSIKTLLGSSLLALSLLSHPASATEKAAPIHFGDITWESGSLITEILRLIVEKGYGYPT
DTLPGSTVSLEAALAKNDIQVIGEEWAGRSPAWVKAAAEGKVFGLGDTVKGATEGWWVPE
YVIKGDPERGIKPLAPELKSVADLAKYKDVFRDPEDPSRGRFLNSPTGWTSEIVNSQKLK
AYDLTASYVNFRTGSGAALDAEVASSIRRGKPVLFYYWSPTPLLGRFKLVKLDEPPFDAE
AWKTLADANNPNPKGTRSMPASLAIGVSAPFKAQYPDLVTFFEKVDLPIDLLNQTLGQMS
EKRQKPREVAEAFLREQPQVWKGWVPGEVATKVSASL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory