Comparing PfGW456L13_1964 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1964 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
43% identity, 100% coverage: 1:257/258 of query aligns to 1:259/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
43% identity, 91% coverage: 24:257/258 of query aligns to 1:234/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
43% identity, 91% coverage: 24:257/258 of query aligns to 4:237/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
43% identity, 91% coverage: 24:257/258 of query aligns to 4:237/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
43% identity, 91% coverage: 24:257/258 of query aligns to 4:237/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
43% identity, 91% coverage: 24:257/258 of query aligns to 4:237/238 of 1lafE
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
44% identity, 90% coverage: 26:257/258 of query aligns to 6:237/238 of 1hslA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
44% identity, 90% coverage: 26:257/258 of query aligns to 28:259/260 of P02910
Sites not aligning to the query:
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
44% identity, 90% coverage: 26:257/258 of query aligns to 28:259/260 of P0AEU0
Sites not aligning to the query:
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
38% identity, 88% coverage: 26:251/258 of query aligns to 6:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
38% identity, 88% coverage: 26:251/258 of query aligns to 6:223/225 of 4zv2A
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
33% identity, 92% coverage: 17:254/258 of query aligns to 1:264/267 of 8hqrA
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
38% identity, 88% coverage: 26:251/258 of query aligns to 4:225/225 of 3tqlA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
33% identity, 88% coverage: 24:251/258 of query aligns to 6:227/228 of 2y7iA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
32% identity, 90% coverage: 22:254/258 of query aligns to 1:252/259 of 5ovzA
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
32% identity, 90% coverage: 22:254/258 of query aligns to 1:252/255 of 5itoA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
32% identity, 90% coverage: 24:254/258 of query aligns to 2:251/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
32% identity, 90% coverage: 24:254/258 of query aligns to 2:251/254 of 5ot9A
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
32% identity, 90% coverage: 24:254/258 of query aligns to 2:251/254 of 4powA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
32% identity, 90% coverage: 24:254/258 of query aligns to 2:251/256 of 5otcA
>PfGW456L13_1964 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1964
MKKLVLLGALALSVLSLPTFADEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEE
MKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITEDRKKSVDFTNKYYNTPARLVMKAGT
QVSEGLTELKGKNIGVQRGSIHERFAREVLAPLGAEIKPYGSQNEIYLDVAAGRLDGTVA
DATLLDDGFLKTDAGKGFAFVGPAFTDVKYFGDGVGIAVRKGDKEDLDKLNNAIVAIRAN
GKYKQIQDKYFAFDIYGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory