SitesBLAST
Comparing PfGW456L13_2058 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2058 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
81% identity, 98% coverage: 5:253/253 of query aligns to 3:251/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G16 (= G18), I17 (= I19), D36 (= D38), L37 (≠ M39), C61 (= C63), D62 (≠ N64), V63 (= V65), N89 (= N91), A90 (= A92), T140 (= T142), S142 (= S144), Y155 (= Y157), K159 (= K161), A186 (= A188), V187 (= V189)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
42% identity, 98% coverage: 5:252/253 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G18), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ M39), A61 (≠ C63), D62 (≠ N64), T63 (≠ V65), N89 (= N91), A90 (= A92), M140 (≠ T142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (= A188), Y187 (≠ V189), I188 (= I190), L192 (≠ M194)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
41% identity, 100% coverage: 1:252/253 of query aligns to 1:254/255 of 5itvA
- active site: G18 (= G18), S141 (= S144), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ A17), G18 (= G18), I19 (= I19), D38 (= D38), I39 (≠ M39), T61 (≠ C63), I63 (≠ V65), N89 (= N91), G91 (= G93), T139 (= T142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (≠ A188), I186 (≠ V189), I187 (= I190)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
41% identity, 99% coverage: 3:252/253 of query aligns to 1:247/248 of 4urfB
- active site: G16 (= G18), S142 (= S144), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ V215), R211 (≠ G216), R212 (= R217)
- binding bicarbonate ion: I92 (= I94), G94 (≠ I96), R109 (≠ A111), R179 (= R181), S228 (= S233)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ M39), D62 (≠ N64), T63 (≠ V65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (≠ T142), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (= A188), I188 (= I190), T190 (= T192)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
41% identity, 99% coverage: 3:252/253 of query aligns to 1:247/248 of 4urfA
- active site: G16 (= G18), S142 (= S144), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I94), S93 (≠ E95), G94 (≠ I96), E95 (= E97), T97 (≠ G99), E101 (= E103), T103 (= T105), Q106 (≠ E108), R109 (≠ A111), S175 (≠ K177), G177 (≠ K179)
- binding magnesium ion: S237 (≠ H242), Y238 (≠ S243)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ M39), W41 (≠ G43), D62 (≠ N64), T63 (≠ V65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (≠ T142), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (= I190), T190 (= T192)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
41% identity, 99% coverage: 3:252/253 of query aligns to 1:247/248 of 4ureB
- active site: G16 (= G18), S142 (= S144), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ A17), G16 (= G18), I17 (= I19), N89 (= N91), G91 (= G93), Y155 (= Y157), P185 (= P187), A186 (= A188)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
41% identity, 100% coverage: 1:252/253 of query aligns to 1:226/227 of 5itvD
- active site: G18 (= G18), S141 (= S144), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ A17), G18 (= G18), I19 (= I19), D38 (= D38), I39 (≠ M39), T61 (≠ C63), D62 (≠ N64), I63 (≠ V65), N89 (= N91), T139 (= T142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (≠ A188), I187 (= I190)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
37% identity, 100% coverage: 1:252/253 of query aligns to 4:252/258 of 4wecA
- active site: G21 (= G18), S143 (= S144), Q154 (≠ M154), Y157 (= Y157), K161 (= K161)
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), A19 (= A16), S20 (≠ A17), G21 (= G18), I22 (= I19), D41 (= D38), I42 (≠ M39), V61 (≠ C63), D62 (≠ N64), V63 (= V65), N89 (= N91), T141 (= T142), Y157 (= Y157), K161 (= K161), P187 (= P187), P189 (≠ V189), V190 (≠ I190)
4qecA Elxo with NADP bound (see paper)
34% identity, 95% coverage: 10:249/253 of query aligns to 5:244/248 of 4qecA
- active site: G13 (= G18), N111 (= N116), S139 (= S144), Y152 (= Y157), K156 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ A17), G13 (= G18), I14 (= I19), S33 (≠ D38), R34 (≠ M39), K38 (≠ G43), D59 (≠ N64), V60 (= V65), N86 (= N91), A87 (= A92), G88 (= G93), I137 (≠ T142), Y152 (= Y157), K156 (= K161), P182 (= P187), I185 (= I190)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
40% identity, 97% coverage: 5:250/253 of query aligns to 5:242/244 of 4nbuB
- active site: G18 (= G18), N111 (= N116), S139 (= S144), Q149 (≠ M154), Y152 (= Y157), K156 (= K161)
- binding acetoacetyl-coenzyme a: D93 (≠ K98), K98 (≠ E103), S139 (= S144), N146 (≠ A151), V147 (≠ P152), Q149 (≠ M154), Y152 (= Y157), F184 (≠ V189), M189 (= M194), K200 (≠ F208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ A17), G18 (= G18), I19 (= I19), D38 (= D38), F39 (≠ M39), V59 (≠ C63), D60 (≠ N64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), I90 (= I94), T137 (= T142), S139 (= S144), Y152 (= Y157), K156 (= K161), P182 (= P187), F184 (≠ V189), T185 (≠ I190), T187 (= T192), M189 (= M194)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
37% identity, 98% coverage: 5:252/253 of query aligns to 11:265/267 of Q9LBG2
- 17:42 (vs. 11:36, 54% identical) binding
- E103 (= E95) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
37% identity, 98% coverage: 5:252/253 of query aligns to 2:256/258 of 1iy8A
- active site: G15 (= G18), S143 (= S144), Q153 (≠ M154), Y156 (= Y157), K160 (= K161)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), S14 (≠ A17), G15 (= G18), L16 (≠ I19), D35 (= D38), V36 (≠ M39), A62 (vs. gap), D63 (≠ N64), V64 (= V65), N90 (= N91), G92 (= G93), I93 (= I94), T141 (= T142), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (≠ A188), T191 (= T192), P192 (≠ D193), M193 (= M194)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
40% identity, 96% coverage: 8:251/253 of query aligns to 8:246/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
40% identity, 96% coverage: 8:251/253 of query aligns to 8:246/255 of 2dteA
- active site: G18 (= G18), S132 (= S144), Y145 (= Y157), S148 (= S160), K149 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S16 (≠ A16), M17 (≠ A17), G18 (= G18), I19 (= I19), S38 (≠ D40), I39 (≠ V41), C52 (= C63), D53 (≠ N64), V54 (= V65), N80 (= N91), A81 (= A92), I130 (≠ T142), S132 (= S144), Y145 (= Y157), K149 (= K161), P174 (= P187), A175 (= A188), T176 (≠ V189), I177 (= I190), T179 (= T192), P180 (≠ D193), L181 (≠ M194), V182 (≠ F195)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 98% coverage: 3:250/253 of query aligns to 1:245/247 of 4jroC
- active site: G16 (= G18), S142 (= S144), Q152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ A16), R15 (≠ A17), G16 (= G18), I17 (= I19), N35 (≠ A37), Y36 (vs. gap), N37 (≠ D38), G38 (≠ M39), S39 (≠ D40), N63 (= N64), V64 (= V65), N90 (= N91), A91 (= A92), I93 (= I94), I113 (≠ V115), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (= I190), T190 (= T192)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
37% identity, 98% coverage: 2:250/253 of query aligns to 3:245/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G14), R18 (≠ A17), G19 (= G18), I20 (= I19), D39 (= D38), R40 (≠ M39), C63 (= C63), I65 (≠ V65), N91 (= N91), G93 (= G93), I94 (= I94), V114 (= V115), Y155 (= Y157), K159 (= K161), I188 (= I190), T190 (= T192), T193 (≠ F195)
5h5xC Crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
41% identity, 98% coverage: 5:252/253 of query aligns to 11:256/257 of 5h5xC
- active site: G24 (= G18), S151 (= S144), Y164 (= Y157), K168 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G14), S23 (≠ A17), G24 (= G18), I25 (= I19), D44 (= D38), F45 (≠ M39), L69 (≠ C63), D70 (≠ N64), N97 (= N91), A98 (= A92), Y164 (= Y157), K168 (= K161), P194 (= P187), G195 (≠ A188), I197 (= I190), T199 (= T192)
A0A3Q8GL18 (+)-cis,trans-nepetalactol synthase NEPS1; Nepetalactol-related short-chain dehydrogenase; Nepetalactol dehydrogenase; Nepetalactol-related short-chain reductase 1; Nepetalactol-related SDR1; NmNEPS1; EC 5.5.1.34; EC 1.1.1.419 from Nepeta racemosa (Catmint) (Raceme catnip) (see paper)
38% identity, 99% coverage: 1:250/253 of query aligns to 11:262/271 of A0A3Q8GL18
- N125 (= N116) mutation to A: Strongly reduced cis-trans-nepetalactone levels.
- T152 (= T142) mutation to N: Absence of cis-trans-nepetalactone.
- T153 (≠ A143) mutation to A: Almost normal cis-trans-nepetalactone levels.
- T154 (≠ S144) mutation to G: Loss of dehydrogenase activity and strongly enhanced cis-trans-nepetalactol levels associated with a huge increase in Km for cis-trans-nepetalactol.
- P155 (≠ V145) mutation to S: Strongly reduced cis-trans-nepetalactone levels.
- L156 (≠ A146) mutation to S: Reduced dehydrogenase activity and absence of cis-trans-nepetalactone.
- Y167 (= Y157) mutation to F: Absence of cis-trans-nepetalactone.
- K171 (= K161) mutation to M: Absence of cis-trans-nepetalactone.
- S198 (≠ A188) mutation to M: Absence of cis-trans-nepetalactone.
- V199 (= V189) mutation to A: Almost normal cis-trans-nepetalactone levels.
- T202 (= T192) mutation to A: Absence of cis-trans-nepetalactone.
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
38% identity, 99% coverage: 3:252/253 of query aligns to 1:243/251 of H9XP47
- N15 (≠ A17) binding
- M17 (≠ I19) binding
- D36 (= D38) binding
- D60 (≠ N64) binding
- V61 (= V65) binding
- N87 (= N91) binding
- S138 (= S144) binding ; binding
- V139 (= V145) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ A146) binding
- Y151 (= Y157) binding ; binding ; binding
- K155 (= K161) binding
- V184 (≠ I190) binding
- T186 (= T192) binding
- RDK 197:199 (≠ KGE 205:207) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
38% identity, 98% coverage: 5:252/253 of query aligns to 5:245/252 of 6vspB
Query Sequence
>PfGW456L13_2058 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2058
MSMTFSGQVVVVTGGAAGIGRATAQAFAAEGLKVVVADMDVAGGEGTVALIRTAGGEATF
VRCNVTLESDVKNLMEEVINTYGRLDYAFNNAGIEIEKGKLAEGTLDEFDAIMGVNVKGV
WLCMKYQLPLLLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKKI
RVNAVCPAVIDTDMFRRAYEADPKKGEFANAMHPVGRIGKVEEIASAVLYLCSDGAAFTT
GHSLAVDGGVTAF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory