SitesBLAST
Comparing PfGW456L13_2092 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2092 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
30% identity, 91% coverage: 60:762/773 of query aligns to 16:719/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M82), G39 (= G83), Q40 (= Q84), H41 (≠ G85), V42 (= V86), A45 (≠ S89), G79 (≠ D123), G80 (= G124), S81 (= S125), S83 (= S127), V84 (≠ M128), G374 (= G418), F375 (= F419), L379 (≠ S423), L499 (≠ Y534), R500 (= R535), V624 (≠ I664), D625 (≠ N665), Q632 (= Q672), T687 (≠ L729), G688 (= G731), L689 (≠ V732), G690 (= G733), E691 (= E734)
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 58% coverage: 217:661/773 of query aligns to 15:464/748 of 5y6qC
- active site: Q204 (= Q388), P239 (≠ S423), A310 (= A493), V316 (≠ F508), R344 (= R535)
- binding pterin cytosine dinucleotide: G233 (= G417), G234 (= G418), F235 (= F419), I461 (≠ V658), G462 (≠ D659), T463 (≠ C660), G464 (= G661)
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
4uhxA Human aldehyde oxidase in complex with phthalazine and thioridazine (see paper)
26% identity, 48% coverage: 216:585/773 of query aligns to 552:923/1290 of 4uhxA
Sites not aligning to the query:
- active site: 1223, 1224
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 237, 310, 311, 319, 320, 323, 324, 326, 329, 332, 333, 377, 404
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding 10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020, 1079
- binding 10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020
8emtA Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
26% identity, 48% coverage: 216:585/773 of query aligns to 511:887/1254 of 8emtA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 215, 216, 217, 218, 219, 221, 222, 223, 296, 297, 306, 309, 310, 312, 319
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 45, 46, 49, 69, 71, 111, 112, 114, 146, 148
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
26% identity, 48% coverage: 216:585/773 of query aligns to 495:854/1221 of 8emtB
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 210, 211, 213, 214, 216, 217, 218, 291, 292, 300, 304, 305, 307, 314
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 69, 109, 112, 144, 146
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
25% identity, 63% coverage: 170:654/773 of query aligns to 133:649/907 of 4usaA
- active site: I390 (≠ Q388), F425 (≠ S423), R501 (≠ E499), F505 (≠ E503), R533 (= R535)
- binding bicarbonate ion: R460 (≠ H459), A531 (≠ W533), F532 (≠ Y534), Y535 (≠ V537), Q539 (≠ P541)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G174), C139 (≠ E176)
- binding hydrocinnamic acid: I255 (vs. gap), F425 (≠ S423), F494 (= F492), L497 (≠ G495), Y535 (≠ V537), L626 (≠ V632)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ E176), T420 (≠ G418), F421 (= F419), G422 (= G420), R533 (= R535)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
25% identity, 63% coverage: 170:654/773 of query aligns to 133:649/907 of 4us9A
- active site: I390 (≠ Q388), F425 (≠ S423), R501 (≠ E499), F505 (≠ E503), R533 (= R535)
- binding 3-phenylpropanal: I255 (vs. gap), F257 (vs. gap), P258 (vs. gap)
- binding bicarbonate ion: R460 (≠ H459), L498 (≠ M496), A531 (≠ W533), F532 (≠ Y534), Y535 (≠ V537), Q539 (≠ P541)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G174), C139 (≠ E176)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ E176), T420 (≠ G418), F421 (= F419), G422 (= G420), R533 (= R535)
Sites not aligning to the query:
- active site: 869, 870
- binding 3-phenylpropanal: 752
- binding bicarbonate ion: 890, 892
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
25% identity, 63% coverage: 170:654/773 of query aligns to 133:649/907 of 4us8A
- active site: I390 (≠ Q388), F425 (≠ S423), R501 (≠ E499), F505 (≠ E503), R533 (= R535)
- binding bicarbonate ion: R460 (≠ H459), L498 (≠ M496), A531 (≠ W533), F532 (≠ Y534), Y535 (≠ V537), Q539 (≠ P541)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G174), C139 (≠ E176)
- binding benzaldehyde: I255 (vs. gap), I255 (vs. gap), L394 (≠ V392), F425 (≠ S423), F425 (≠ S423), F425 (≠ S423), F425 (≠ S423), L497 (≠ G495), L497 (≠ G495), R501 (≠ E499), A531 (≠ W533), Y535 (≠ V537), Y535 (≠ V537), L626 (≠ V632), L626 (≠ V632), L626 (≠ V632)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ E176), T420 (≠ G418), F421 (= F419), G422 (= G420), R533 (= R535)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding benzaldehyde: 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
25% identity, 63% coverage: 170:654/773 of query aligns to 133:649/907 of 4c7yA
- active site: I390 (≠ Q388), F425 (≠ S423), R501 (≠ E499), F505 (≠ E503), R533 (= R535)
- binding bicarbonate ion: R460 (≠ H459), L498 (≠ M496), A531 (≠ W533), Y535 (≠ V537), Q539 (≠ P541)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G174), C139 (≠ E176)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ E176), T420 (≠ G418), F421 (= F419), G422 (= G420), R533 (= R535)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
25% identity, 63% coverage: 170:654/773 of query aligns to 133:649/907 of 3fc4A
- active site: I390 (≠ Q388), F425 (≠ S423), R501 (≠ E499), F505 (≠ E503), R533 (= R535)
- binding 1,2-ethanediol: Y535 (≠ V537), Y622 (≠ H628)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G174), C139 (≠ E176)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ E176), G419 (= G417), T420 (≠ G418), F421 (= F419), G422 (= G420), R533 (= R535)
Sites not aligning to the query:
- active site: 869, 870
- binding 1,2-ethanediol: 696, 697, 869
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
25% identity, 63% coverage: 170:654/773 of query aligns to 133:649/907 of 3fahA
- active site: I390 (≠ Q388), F425 (≠ S423), R501 (≠ E499), F505 (≠ E503), R533 (= R535)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G174), C139 (≠ E176)
- binding glycerol: P416 (≠ L414), Y535 (≠ V537), Y622 (≠ H628)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ E176), G419 (= G417), T420 (≠ G418), F421 (= F419), G422 (= G420), R533 (= R535)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103
- binding glycerol: 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
25% identity, 63% coverage: 170:654/773 of query aligns to 133:649/907 of 1sijA
- active site: I390 (≠ Q388), F425 (≠ S423), R501 (≠ E499), F505 (≠ E503), R533 (= R535)
- binding arsenite: Y535 (≠ V537)
- binding fe2/s2 (inorganic) cluster: C137 (≠ G174), C139 (≠ E176)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): C139 (≠ E176), T420 (≠ G418), F421 (= F419), G422 (= G420), R533 (= R535)
Sites not aligning to the query:
- active site: 869, 870
- binding arsenite: 696, 697, 869
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 99, 100, 101, 103
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
25% identity, 63% coverage: 170:654/773 of query aligns to 133:649/907 of Q46509
- C137 (≠ G174) binding
- C139 (≠ E176) binding
Sites not aligning to the query:
- 40 binding
- 45 binding
- 48 binding
- 60 binding
- 100 binding
- 103 binding
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 38% coverage: 223:519/773 of query aligns to 560:868/1295 of 6a7xA
Sites not aligning to the query:
- active site: 885, 1233, 1234
- binding bicarbonate ion: 883, 884, 887, 888, 891
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 887, 982, 983, 1052, 1234
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
25% identity, 38% coverage: 223:519/773 of query aligns to 558:866/1286 of 4yswA
Sites not aligning to the query:
- active site: 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 882, 885, 886, 889
- binding calcium ion: 878, 879
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 885, 980, 981, 1050, 1232
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 38% coverage: 223:519/773 of query aligns to 558:866/1291 of 6a7xB
Sites not aligning to the query:
- active site: 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 885, 980, 981, 1049, 1050, 1232
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
25% identity, 38% coverage: 223:519/773 of query aligns to 560:868/1291 of 2e3tA
- active site: Q740 (= Q388), E775 (≠ S423), R853 (≠ L504), H857 (≠ F508)
- binding bicarbonate ion: R812 (≠ F458), H813 (= H459), I850 (≠ A501)
- binding calcium ion: E713 (≠ S363), H714 (≠ Q364), Y716 (≠ P366), T809 (≠ S456), G810 (vs. gap), G840 (= G495), T843 (≠ H498), E844 (= E499), S847 (vs. gap)
- binding fe2/s2 (inorganic) cluster: L717 (≠ M367)
- binding uric acid: E775 (≠ S423), R853 (≠ L504)
Sites not aligning to the query:
- active site: 885, 1233, 1234
- binding bicarbonate ion: 882, 883, 887, 888, 891
- binding calcium ion: 880, 881
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 887, 982, 983, 1051, 1052, 1234
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 38% coverage: 223:519/773 of query aligns to 587:895/1331 of P22985
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
25% identity, 57% coverage: 213:656/773 of query aligns to 7:473/761 of 1rm6A
- active site: Q206 (= Q388), T241 (≠ S423), Y318 (≠ F492), L322 (≠ M496), R350 (= R535)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G235 (= G417), G236 (= G418), F237 (= F419), G238 (= G420), R350 (= R535), I473 (= I656)
Sites not aligning to the query:
- active site: 718, 719
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 474, 475, 476, 513, 514, 515, 517, 518, 646, 647, 651, 654, 714, 715, 716, 717, 718
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
25% identity, 57% coverage: 213:656/773 of query aligns to 15:481/769 of O33819
Sites not aligning to the query:
- 522:526 binding
- 650:655 binding
- 722:725 binding
Query Sequence
>PfGW456L13_2092 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2092
MSRLPNDFALSNLSRRGFLKGVGATGALVVAASWGWQDAFAEEKEKKFGADGMPHGWFDD
PKVYVSIAADGTVTVICNRSEMGQGVRTSLTMVVADELEADWAMVKVQQAPGDEVRFGNQ
DTDGSRSMRHWYEPMRRCGAAARAMLEQAAADQWKVSVGECQAQLHKVIHKPSGRELGYG
ALAAAAGALAVPARESLRLKQPSEFRYIGKEGTKAIDGEDIVNGRAVYGADVHFDGMLYA
TIARPTVYGGKVKSFDGSAAMKVPGVVKVVQIESRPLPSEFQPLGGIAVVASNTWAAIKG
REALKIEWDDGPNASYDSIAYRKELEAASLKPGKVVRKTGNLDEAMASADSTLEASYYLP
HLSQSPMEPMVAIARFKDGACQAWGPSQAPQVTRERIGERLGLPFDKVTFNVTLLGGGFG
RKSKPDFIIEAAILAKEFPGKAVRVQWTREDDIHCSYFHTVSAEYLKASLNKDGLPSGWL
HRTVAPSITALFAPGMNHEAAFELGMGFTNMAYAIPNIRLENPEATVHTRVGWYRSVSNI
PHGFAIQSFIDELAHKAGQDPLKYQIRLLGPDRQIDPRTLSEEWNYGESPERYPIDTARL
RTVLETAAKAAGWGRELPKGRGLGLAVHYSFVTYVAAVIEVEVKDDGTLVVHKADIAVDC
GPQINPERIRAQFEGACVMGLGNAVLGEISFKDGKVQQDNFHMYEVARMSLAPKEVAVHL
VTPPGDVPLGGVGEPGVPPIAPALCNAIFAATGKRIRNLPVRYQLSGWQKAGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory