Comparing PfGW456L13_2120 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2120 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
5abpA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
60% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 5abpA
1abfA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
60% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 1abfA
1abeA Novel stereospecificity of the l-arabinose-binding protein (see paper)
60% identity, 90% coverage: 32:332/334 of query aligns to 2:302/305 of 1abeA
4kzkA The structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
45% identity, 90% coverage: 32:332/334 of query aligns to 1:301/301 of 4kzkA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
25% identity, 66% coverage: 33:252/334 of query aligns to 4:217/287 of 5dteB
Sites not aligning to the query:
>PfGW456L13_2120 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2120
MNRRHAIRSLCCAALAVSAFSLSNTLLAAEEVKIGFLVKQAEEPWFQTEWAFAEKAGKEK
GFTLIKIAVPDGEKTLSAIDSLAANGAKGFVICPPDVSLGPAIMAKAKLNGLKVIAVDDR
FVDASGKFMEDVPYLGMAAFEVGQKQGNAMATEAKKRGWDWKDTYAVINTYNELDTGKKR
TDGSVKALQDAGMPKDHILFAALKTLDVPGSMDATNSALVKLPGAAKNLIIGGMNDNTVL
GGVRATESAGFAAANVIGIGINGTDAIGELKKPDSGFYGSMLPSPHIEGYNTASMMYEWV
TTGKEPAKYTAMDDVTLITRDNFKQELEKIGLWN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory