Comparing PfGW456L13_2177 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2177 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WML5 Aromatic amino acid aminotransferase; ArAT; Phenylalanine aminotransferase; EC 2.6.1.57 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 95% coverage: 10:361/370 of query aligns to 6:344/353 of P9WML5
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
36% identity, 95% coverage: 10:361/370 of query aligns to 6:344/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
36% identity, 95% coverage: 10:361/370 of query aligns to 6:344/353 of 4r2nA
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
30% identity, 96% coverage: 13:366/370 of query aligns to 8:359/360 of 8bj3A
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
33% identity, 88% coverage: 41:367/370 of query aligns to 35:365/369 of 4wbtA
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
33% identity, 81% coverage: 66:364/370 of query aligns to 50:350/353 of 7szpA
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
32% identity, 89% coverage: 40:367/370 of query aligns to 30:362/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
32% identity, 89% coverage: 40:367/370 of query aligns to 28:360/364 of 3cq6A
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
31% identity, 88% coverage: 40:366/370 of query aligns to 30:361/369 of 4r8dA
P9WML7 Histidinol-phosphate aminotransferase; HspAT; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 88% coverage: 40:366/370 of query aligns to 34:365/380 of P9WML7
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
28% identity, 85% coverage: 40:355/370 of query aligns to 19:337/354 of 3ly1D
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
29% identity, 81% coverage: 66:363/370 of query aligns to 50:349/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
29% identity, 81% coverage: 66:363/370 of query aligns to 50:349/354 of 1fg3A
Sites not aligning to the query:
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
29% identity, 81% coverage: 66:363/370 of query aligns to 36:335/335 of 1geyA
Sites not aligning to the query:
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
34% identity, 74% coverage: 90:363/370 of query aligns to 71:325/328 of 1uu0A
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
34% identity, 74% coverage: 90:363/370 of query aligns to 77:331/335 of Q9X0D0
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
34% identity, 74% coverage: 90:363/370 of query aligns to 72:326/329 of 1uu1A
Sites not aligning to the query:
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
34% identity, 74% coverage: 90:363/370 of query aligns to 72:326/329 of 1h1cA
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
34% identity, 74% coverage: 90:363/370 of query aligns to 78:332/335 of 2f8jA
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
28% identity, 94% coverage: 22:368/370 of query aligns to 9:358/364 of P97084
Sites not aligning to the query:
>PfGW456L13_2177 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2177
MSGNFLALAQPGVQQLSPYVPGKPVDELARELDLDPASIIKLASNENPLGAGPKALAAIR
DALAELTRYPDGNGFALKSLLAEQCRVELDQVTLGNGSNDILELVARAYLAPGLNAVFSE
HAFAVYPIATQAVGAQAKVVPAKDWGHDLPAMLAAIDANTRVVFIANPNNPTGTWFDAEA
LDEFLQDVPEHVLVVLDEAYIEYAEGSDLPDGLDFLAAYPNLLVSRTFSKAYGLAALRVG
YGLSTAVVADVLNRVRQPFNVNSLALAAACAALKDEEYLAQSRQLNESGMQQLEAGFREL
GLSWIPSKGNFICVDLGQVAAPVFQGLLREGVIVRPVANYGMPNHLRITIGLPAENSRFL
EALTKVLARG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory