Comparing PfGW456L13_2287 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2287 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3u9sF Crystal structure of p. Aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, coa complex (see paper)
46% identity, 100% coverage: 1:538/538 of query aligns to 3:537/537 of 3u9sF
8j4zJ Human 3-methylcrotonyl-coa carboxylase in bccp-cts state with substrate
43% identity, 99% coverage: 6:537/538 of query aligns to 11:540/541 of 8j4zJ
8rthF Trypanosoma brucei 3-methylcrotonyl-coa carboxylase (see paper)
42% identity, 95% coverage: 3:513/538 of query aligns to 21:531/542 of 8rthF
8j99B Human 3-methylcrotonyl-coa carboxylase in bcs-mcoa state
40% identity, 99% coverage: 6:537/538 of query aligns to 11:513/514 of 8j99B
8f3dA 3-methylcrotonyl-coa carboxylase in filament, beta-subunit centered (see paper)
43% identity, 86% coverage: 50:513/538 of query aligns to 85:555/566 of 8f3dA
1vrgA Crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution
31% identity, 94% coverage: 21:527/538 of query aligns to 2:506/515 of 1vrgA
Q168G2 Propionyl-CoA carboxylase beta chain; EC 6.4.1.3 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
32% identity, 86% coverage: 50:510/538 of query aligns to 30:483/510 of Q168G2
3n6rB Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
32% identity, 86% coverage: 50:510/538 of query aligns to 26:479/506 of 3n6rB
8pn7A Engineered glycolyl-coa carboxylase (g20r variant) with bound coa (see paper)
31% identity, 76% coverage: 48:454/538 of query aligns to 24:435/506 of 8pn7A
Sites not aligning to the query:
1on3E Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) (see paper)
30% identity, 94% coverage: 20:527/538 of query aligns to 7:511/520 of 1on3E
7ybuP Human propionyl-coenzyme a carboxylase
30% identity, 90% coverage: 48:532/538 of query aligns to 27:503/507 of 7ybuP
3ib9A Propionyl-coa carboxylase beta subunit, d422l (see paper)
30% identity, 89% coverage: 30:510/538 of query aligns to 14:494/521 of 3ib9A
1on3C Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) (see paper)
29% identity, 94% coverage: 20:527/538 of query aligns to 3:501/510 of 1on3C
1xnyA Biotin and propionyl-coa bound to acyl-coa carboxylase beta subunit from s. Coelicolor (pccb) (see paper)
30% identity, 89% coverage: 30:510/538 of query aligns to 14:494/521 of 1xnyA
8sgxE Leishmania tarentolae propionyl-coa carboxylase (alpha-4-beta-6) (see paper)
28% identity, 89% coverage: 48:524/538 of query aligns to 9:470/489 of 8sgxE
5iniF Structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics (see paper)
29% identity, 81% coverage: 18:455/538 of query aligns to 4:435/511 of 5iniF
Sites not aligning to the query:
4g2rB Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor haloxyfop from mycobacterium tuberculosis (see paper)
28% identity, 73% coverage: 64:455/538 of query aligns to 1:377/441 of 4g2rB
3gmaB Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co- crystallized with glutaryl-coa (see paper)
25% identity, 79% coverage: 1:426/538 of query aligns to 11:454/566 of 3gmaB
3gf3A Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co- crystallized with glutaconyl-coa (see paper)
25% identity, 79% coverage: 1:426/538 of query aligns to 11:450/563 of 3gf3A
6tzvA Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis
27% identity, 73% coverage: 63:455/538 of query aligns to 1:362/426 of 6tzvA
>PfGW456L13_2287 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2287
MPVIQSQLDPHSESFAQNRAAMLSAIEQVRVLEQNLLNKAAEARPKFEKRGQLLPRERLN
LLLDPGAPFLELASLAGYKLHDDKDGSSAGGGLIAGIGYVSGVRVLVVANNSAIRGGTIS
PSGLKKSLRLQQIAMENKLPVITLAESGGANLNYAAEIFVEGARSFANQARMSAMGLPQV
TVVHGSATAGGAYQPGLSDYVVVVRGKAKLFLAGPPLLKAATGEVATDEELGGAEMHAQT
AGTAEYLAENDADGVRQVREIISLLPWNEQLPPLPERRWEEPLYPIDELLGLIPDDPKKP
YDAREIIARLADASNFLEFKGEFDQQTLCGHLKIQGRACGFIGNNGPITPKGASKAAQFI
QLCDQSQTPLLFFHNTTGFMVGTESEQQGVIKHGAKMIQAVANARVPKLTIVVGGSYGAG
NYAMCGRGLDPRFIFAWPNSRTAVMGGAQAGKVLRIVTEAKQAKDGLVPDPKMLDMLEQV
TAQKLDSQSTALYGSANLWDDGLIDPRDTRTLLGYLLDICHEAEVRPLQANSFGVARF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory