Comparing PfGW456L13_2301 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2301 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rl5G The first crystal structure of the daba aminotransferase ectb in the ectoine biosynthesis pathway of the model organism chromohalobacter salexigens dsm 3034 (see paper)
37% identity, 91% coverage: 33:458/466 of query aligns to 7:422/422 of 6rl5G
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
38% identity, 89% coverage: 47:460/466 of query aligns to 21:387/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
38% identity, 89% coverage: 47:460/466 of query aligns to 21:387/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
38% identity, 89% coverage: 47:460/466 of query aligns to 21:387/387 of 1vefA
Sites not aligning to the query:
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
38% identity, 89% coverage: 47:460/466 of query aligns to 29:395/395 of Q5SHH5
P50457 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 from Escherichia coli (strain K12) (see paper)
36% identity, 88% coverage: 50:460/466 of query aligns to 27:420/421 of P50457
7vo1A Structure of aminotransferase-substrate complex (see paper)
32% identity, 94% coverage: 27:463/466 of query aligns to 16:444/452 of 7vo1A
7vntA Structure of aminotransferase-substrate complex (see paper)
32% identity, 94% coverage: 27:463/466 of query aligns to 16:444/452 of 7vntA
7vnoA Structure of aminotransferase (see paper)
32% identity, 94% coverage: 27:463/466 of query aligns to 16:444/452 of 7vnoA
O50131 Ornithine aminotransferase; Orn-AT; Ornithine delta-aminotransferase; EC 2.6.1.13 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
32% identity, 94% coverage: 27:463/466 of query aligns to 18:446/454 of O50131
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
33% identity, 86% coverage: 59:461/466 of query aligns to 72:445/453 of 4uoxA
Sites not aligning to the query:
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
33% identity, 86% coverage: 59:461/466 of query aligns to 78:451/459 of P42588
4uoxC Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
33% identity, 86% coverage: 59:461/466 of query aligns to 76:449/456 of 4uoxC
Sites not aligning to the query:
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 93% coverage: 31:462/466 of query aligns to 9:424/426 of P22256
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
33% identity, 93% coverage: 31:462/466 of query aligns to 8:423/425 of 1sffA
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
33% identity, 93% coverage: 31:462/466 of query aligns to 8:423/425 of 1sf2A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
31% identity, 89% coverage: 44:459/466 of query aligns to 10:376/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
31% identity, 89% coverage: 44:459/466 of query aligns to 9:375/375 of 2eh6A
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
33% identity, 93% coverage: 31:462/466 of query aligns to 8:423/425 of 1szkA
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
35% identity, 89% coverage: 36:448/466 of query aligns to 1:378/390 of 8ht4B
>PfGW456L13_2301 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2301
MSVATNLIEEQPATSAETLYQFNESPLLARQSRQESNARSYPRRIPLALKRAKGIYVEDV
EGRTFIDCLAGAGTLALGHNHPVVIEAIQQVLADELPLHTLDLTTPVKDRFVQDLFGLLP
PALAAEAKIQFCGPTGTDAVEAALKLVRTATGRSTVISFQGGYHGMSQGALSLMGSLGPK
KPLGALLGSGVQFMPYPYDYRCPFGLGGAQGVKANLSYLENLLNDPEAGVQLPAAVIVEV
VQGEGGVIPADLDWLRGVRRITEQAGVALIVDEIQSGFARTGKMFAFEHAGIIPDVVVMS
KAIGGSLPLAVVVYRDWLDTWLPGAHAGTFRGNQMAMAAGCAVMRYLVEHKVCEHAAAMG
ERLAEHLRILQRDFPQLGDIRGRGLMLGVELVDPTGALDAQGHPPAFARLAPLVQRECLK
RGLILELGGRHGAVVRFLPPLVITAAQIDRVAEIFGRALAAATANP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory