Comparing PfGW456L13_2328 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2328 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
25% identity, 81% coverage: 71:440/459 of query aligns to 49:434/446 of A0A0H2VG78
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 35% coverage: 71:230/459 of query aligns to 90:256/583 of Q9Y7Q9
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
23% identity, 86% coverage: 62:458/459 of query aligns to 54:490/491 of P0AGF4
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
23% identity, 70% coverage: 62:381/459 of query aligns to 50:407/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
23% identity, 70% coverage: 62:381/459 of query aligns to 50:407/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
23% identity, 70% coverage: 62:381/459 of query aligns to 50:407/475 of 4gbyA
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 44% coverage: 36:236/459 of query aligns to 56:233/444 of Q8NLB7
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 82% coverage: 72:449/459 of query aligns to 110:564/587 of P25297
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 70% coverage: 77:398/459 of query aligns to 188:513/616 of P36035
Sites not aligning to the query:
Q9VCA2 Organic cation transporter protein from Drosophila melanogaster (Fruit fly) (see paper)
25% identity, 69% coverage: 75:389/459 of query aligns to 139:468/548 of Q9VCA2
Sites not aligning to the query:
>PfGW456L13_2328 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2328
MSDLSSAEKSGAPPEVAISMKKVAVASVIGTTVEWYDLFVFATASALVFNKVFFPDFVPL
IGTLLAFGTFASAYLARIVGAALFGHFGDRLGRKSMLLISLLTMGAATFAIGLLPDFATI
GIWAPILLLLLRVVQGLALGGEWGGAVLMAVEHAPANKRGLYGSWVQIGVPAGTMIANLA
FLLIAAWLSPEDLLAWGWRIPFLASVLLIAVGLYIRLNISETPAFNKVKEAEVQVKMPLA
EVFRKYWKQVLLGGIATMSTGASFNIIVAFGLTYGTQNLGFSRSVMLGVVLLSCAWCIVM
LPVFGALSDRFGRKPIIVGGIIAEALVAFPMFWLMDTKELSMVVFGYLLLMTAFAANYGP
IATFLAELFGTRVRYSGLSISYMLSGLLGSAATPIVTTALLAATGKGSSVAWYMIGAALI
SLVALLLLTETFKKDISEIPSVVPTDDPAPGKPFKSATA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory