Comparing PfGW456L13_2423 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2423 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
28% identity, 84% coverage: 54:355/358 of query aligns to 55:322/322 of P33164
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
28% identity, 84% coverage: 54:355/358 of query aligns to 54:321/321 of 2piaA
Sites not aligning to the query:
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
27% identity, 68% coverage: 4:245/358 of query aligns to 154:397/403 of 3ozwA
Sites not aligning to the query:
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
27% identity, 68% coverage: 4:245/358 of query aligns to 154:397/403 of 3ozvA
Sites not aligning to the query:
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
27% identity, 68% coverage: 4:245/358 of query aligns to 154:397/403 of 3ozuA
Sites not aligning to the query:
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
27% identity, 68% coverage: 4:245/358 of query aligns to 154:397/403 of P39662
Sites not aligning to the query:
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
27% identity, 68% coverage: 4:245/358 of query aligns to 154:397/403 of 1cqxA
Sites not aligning to the query:
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
27% identity, 68% coverage: 2:246/358 of query aligns to 103:336/337 of 1krhA
Sites not aligning to the query:
1rfkB Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus (see paper)
43% identity, 25% coverage: 265:352/358 of query aligns to 1:89/97 of 1rfkB
7ylrA Structure of a bacteria protein
28% identity, 89% coverage: 36:354/358 of query aligns to 36:326/326 of 7ylrA
6khi1 Supercomplex for cylic electron transport in cyanobacteria (see paper)
41% identity, 25% coverage: 265:353/358 of query aligns to 2:90/98 of 6khi1
7fixR1 Photosystem I reaction center subunit PsaK (see paper)
41% identity, 25% coverage: 265:353/358 of query aligns to 1:89/97 of 7fixR1
3b2gA Leptolyngbya boryana ferredoxin (see paper)
42% identity, 24% coverage: 268:353/358 of query aligns to 4:90/98 of 3b2gA
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
49% identity, 19% coverage: 285:353/358 of query aligns to 21:89/97 of 7s3dX
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
41% identity, 25% coverage: 265:352/358 of query aligns to 2:90/99 of P0A3C7
Sites not aligning to the query:
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
41% identity, 25% coverage: 265:352/358 of query aligns to 1:89/98 of 1ewyC
1czpA Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a (see paper)
41% identity, 25% coverage: 265:352/358 of query aligns to 1:89/98 of 1czpA
6xtfD Crystal structure a thioredoxin reductase from gloeobacter violaceus bound to its electron donor (see paper)
40% identity, 24% coverage: 265:349/358 of query aligns to 1:84/96 of 6xtfD
7y5eNN Phycobilisome 31.8 kDa linker polypeptide, phycoerythrin-associated, rod (see paper)
51% identity, 18% coverage: 289:353/358 of query aligns to 27:91/99 of 7y5eNN
3ab5A Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
45% identity, 18% coverage: 287:352/358 of query aligns to 23:88/97 of 3ab5A
>PfGW456L13_2423 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2423
MSKFHSLTIKDVRAETRDAVSIAFEIPQDLQDSFHFTQGQHLVMRTQLDGEEVRRSYSIC
TGVNDGELRIAVKRVTGGRFSAFANEQLKAGHTLEVMPPAGHFCVELDPARHGNYLAVAA
GSGITPILSIIKTTLETEPHSRVTLLYGNRSSSGALFREQLEDLKNRYLQRLNLIFVFSR
EQQDVDLYNGRINAEKCEQLFSRWLDIKALDAAFICGPQEMTETVRDSLKAKGMAPERIH
FELFAAAGSQQKREAREAARQVDSAVSQITVISDGRALAFDLPRNSQSILDAGNAQGAEL
PYSCKAGVCSTCKCKVIEGEVEMDSNHALEDYEVAAGYVLSCQAFPISDKVVLDFDQL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory