SitesBLAST
Comparing PfGW456L13_2428 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2428 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
2y27B Crystal structure of paak1 in complex with atp from burkholderia cenocepacia (see paper)
72% identity, 96% coverage: 14:438/441 of query aligns to 4:427/427 of 2y27B
- binding adenosine-5'-triphosphate: K65 (= K75), S90 (= S100), S91 (= S101), G92 (= G102), T93 (= T103), T94 (= T104), F138 (= F148), A211 (= A221), E212 (= E222), P213 (= P223), D232 (= D242), I233 (= I243), Y234 (= Y244), G235 (= G245), L236 (= L246), S237 (= S247), D302 (= D312), I320 (= I330), R323 (= R333), K419 (= K430)
- binding magnesium ion: V200 (≠ H210), S202 (≠ L212), L204 (= L214), M226 (= M236), G227 (= G237), Q347 (≠ V357), L350 (= L360)
2y4nA Paak1 in complex with phenylacetyl adenylate (see paper)
71% identity, 96% coverage: 14:438/441 of query aligns to 4:425/426 of 2y4nA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: Y131 (= Y143), F136 (= F148), G138 (= G150), G208 (= G220), A209 (= A221), E210 (= E222), P211 (= P223), I231 (= I243), Y232 (= Y244), G233 (= G245), L234 (= L246), S235 (= S247), P240 (= P252), D300 (= D312), R321 (= R333), K417 (= K430)
- binding magnesium ion: V198 (≠ H210), S200 (≠ L212), Q345 (≠ V357), L348 (= L360)
2y4oA Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
68% identity, 96% coverage: 14:438/441 of query aligns to 6:432/433 of 2y4oA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (≠ Y143), F140 (= F148), A213 (= A221), E214 (= E222), P215 (= P223), I235 (= I243), G237 (= G245), L238 (= L246), S239 (= S247), P244 (= P252), D304 (= D312), R325 (= R333), I331 (= I339), N336 (= N344)
2y4oB Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
68% identity, 96% coverage: 14:438/441 of query aligns to 6:432/432 of 2y4oB
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (≠ Y143), F140 (= F148), G212 (= G220), A213 (= A221), E214 (= E222), P215 (= P223), I235 (= I243), G237 (= G245), L238 (= L246), S239 (= S247), P244 (= P252), D304 (= D312), R325 (= R333), I331 (= I339), N336 (= N344)
- binding magnesium ion: S204 (≠ L212), V228 (≠ M236)
4r1mA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution
45% identity, 96% coverage: 15:438/441 of query aligns to 9:433/435 of 4r1mA
- binding adenosine monophosphate: A215 (= A221), E216 (= E222), P217 (= P223), N236 (≠ D242), S237 (≠ I243), F238 (≠ Y244), G239 (= G245), M240 (≠ L246), T241 (≠ S247), D305 (= D312), R329 (= R333), I335 (= I339), N340 (= N344)
- binding zinc ion: C252 (= C258), H259 (≠ T266), C314 (vs. gap), C316 (≠ T320)
4r1lA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution
44% identity, 96% coverage: 15:438/441 of query aligns to 9:431/433 of 4r1lA
- binding adenosine-5'-diphosphate: A215 (= A221), E216 (= E222), P217 (= P223), S237 (≠ I243), F238 (≠ Y244), G239 (= G245), M240 (≠ L246), T241 (≠ S247), D305 (= D312), R329 (= R333), N340 (= N344)
- binding adenosine monophosphate: A215 (= A221), E216 (= E222), P217 (= P223), S237 (≠ I243), F238 (≠ Y244), G239 (= G245), M240 (≠ L246), T241 (≠ S247), D305 (= D312), R329 (= R333), N340 (= N344)
- binding coenzyme a: S136 (= S142), A164 (≠ G170), G165 (= G171), N166 (≠ Q172), S167 (≠ T173), I185 (≠ T191), Y188 (= Y194), K337 (≠ R341), T408 (≠ S413)
- binding zinc ion: C252 (= C258), H259 (≠ T266), C314 (vs. gap), C316 (≠ T320)
6he0A Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state (see paper)
30% identity, 95% coverage: 18:438/441 of query aligns to 30:464/477 of 6he0A
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] 2-methyl-2-oxidanyl-propanoate: S241 (≠ G220), G242 (≠ A221), E243 (= E222), P244 (= P223), G267 (≠ Y244), S268 (≠ G245), M269 (≠ L246), A270 (≠ S247), D335 (= D312), I357 (= I330), N371 (= N344)
- binding adenosine monophosphate: G242 (≠ A221), E243 (= E222), P244 (= P223), C266 (≠ I243), G267 (≠ Y244), S268 (≠ G245), A270 (≠ S247), E271 (= E248), D335 (= D312), N371 (= N344)
- binding coenzyme a: Y166 (≠ F148), A188 (≠ G170), G189 (vs. gap), P191 (vs. gap), S194 (≠ T173), Y210 (≠ M189), G211 (≠ V190), T212 (= T191), Y215 (= Y194), H218 (≠ N197), R368 (= R341), G369 (= G342), M401 (≠ L374), V439 (≠ I412), R440 (≠ S413)
6hdyA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with s3-hb-amp (see paper)
29% identity, 95% coverage: 18:438/441 of query aligns to 30:461/474 of 6hdyA
- binding (3s)-3-hydroxybutanoic acid: Y162 (≠ F148), S237 (≠ G220), G263 (≠ Y244), S264 (≠ G245), M265 (≠ L246), A266 (≠ S247), F271 (≠ G253)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (3~{S})-3-oxidanylbutanoate: Y162 (≠ F148), G164 (= G150), S237 (≠ G220), G238 (≠ A221), E239 (= E222), P240 (= P223), C262 (≠ I243), G263 (≠ Y244), S264 (≠ G245), A266 (≠ S247), F271 (≠ G253), D331 (= D312), I353 (= I330), R356 (= R333), K453 (= K430)
6hdxA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with r3-hib-amp (see paper)
29% identity, 95% coverage: 18:438/441 of query aligns to 30:461/474 of 6hdxA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (2~{R})-2-methyl-3-oxidanyl-propanoate: Y162 (≠ F148), G164 (= G150), S237 (≠ G220), G238 (≠ A221), E239 (= E222), P240 (= P223), C262 (≠ I243), G263 (≠ Y244), S264 (≠ G245), A266 (≠ S247), F271 (≠ G253), D331 (= D312), I353 (= I330), R356 (= R333), K453 (= K430)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: Y162 (≠ F148), G164 (= G150), S237 (≠ G220), G263 (≠ Y244), S264 (≠ G245), A266 (≠ S247), F271 (≠ G253)
6siyA Paak family amp-ligase with amp and substrate (see paper)
28% identity, 90% coverage: 20:417/441 of query aligns to 12:394/433 of 6siyA
- binding 3-hydroxyanthranilic acid: T125 (≠ Y143), P126 (≠ G144), T132 (≠ G150), L135 (≠ G153), R153 (≠ G171), N177 (≠ T191), A209 (= A221), E232 (≠ I243), G234 (= G245), S235 (≠ L246)
- binding adenosine monophosphate: S85 (= S101), A209 (= A221), E210 (= E222), P211 (= P223), E232 (≠ I243), Y233 (= Y244), G234 (= G245), S235 (≠ L246), T236 (≠ S247), D296 (= D312), V316 (≠ I330)
- binding magnesium ion: R75 (≠ M91), E76 (≠ H92), L78 (≠ I94), P117 (≠ R135), G144 (= G162), A145 (≠ C163), T146 (= T164)
6sixB Paak family amp-ligase with anp (see paper)
28% identity, 90% coverage: 20:417/441 of query aligns to 16:398/437 of 6sixB
- binding phosphoaminophosphonic acid-adenylate ester: S88 (= S100), S89 (= S101), A213 (= A221), E214 (= E222), P215 (= P223), E236 (≠ I243), Y237 (= Y244), G238 (= G245), S239 (≠ L246), T240 (≠ S247), E241 (= E248), D300 (= D312), V320 (≠ I330), R323 (= R333)
- binding magnesium ion: R79 (≠ M91), E80 (≠ H92), P121 (≠ R135), T150 (= T164)
- binding zinc ion: C249 (= C258), H255 (≠ T266), C309 (≠ G319), C311 (≠ A321)
6siwA Paak family amp-ligase with amp (see paper)
28% identity, 90% coverage: 20:417/441 of query aligns to 11:393/432 of 6siwA
- binding adenosine monophosphate: S84 (= S101), A208 (= A221), E209 (= E222), P210 (= P223), E231 (≠ I243), Y232 (= Y244), G233 (= G245), S234 (≠ L246), T235 (≠ S247), D295 (= D312), V315 (≠ I330)
- binding magnesium ion: E75 (≠ H92), L77 (≠ I94), S83 (= S100), P116 (≠ R135), G143 (= G162), T145 (= T164), E236 (= E248)
- binding zinc ion: C244 (= C258), H250 (≠ T266), C304 (≠ G319), C306 (≠ A321)
P40806 Polyketide synthase PksJ; PKS from Bacillus subtilis (strain 168) (see paper)
24% identity, 74% coverage: 93:418/441 of query aligns to 188:534/5043 of P40806
Sites not aligning to the query:
- 1689 modified: O-(pantetheine 4'-phosphoryl)serine
3ni2A Crystal structures and enzymatic mechanisms of a populus tomentosa 4- coumarate:coa ligase (see paper)
28% identity, 46% coverage: 93:293/441 of query aligns to 175:381/528 of 3ni2A
- active site: S182 (= S100), S202 (≠ W120), H230 (= H140), T329 (≠ S247), E330 (= E248)
- binding 5'-O-{(S)-hydroxy[3-(4-hydroxyphenyl)propoxy]phosphoryl}adenosine: Y232 (≠ S142), S236 (≠ G146), G302 (≠ A221), A303 (≠ E222), P304 (= P223), G325 (≠ I243), G327 (= G245), T329 (≠ S247), P333 (= P252), V334 (≠ G253)
Sites not aligning to the query:
3a9vA Crystal structures and enzymatic mechanisms of a populus tomentosa 4- coumarate--coa ligase (see paper)
28% identity, 46% coverage: 93:293/441 of query aligns to 175:381/528 of 3a9vA
- active site: S182 (= S100), S202 (≠ W120), H230 (= H140), T329 (≠ S247), E330 (= E248)
- binding adenosine monophosphate: H230 (= H140), G302 (≠ A221), A303 (≠ E222), P304 (= P223), Y326 (= Y244), G327 (= G245), M328 (≠ L246), T329 (≠ S247)
Sites not aligning to the query:
Q84P21 Peroxisomal OPC-8:0-CoA ligase 1; 4-coumarate--CoA ligase isoform 9; At4CL9; 4-coumarate--CoA ligase-like 5; EC 6.2.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 46% coverage: 89:293/441 of query aligns to 186:392/546 of Q84P21
Sites not aligning to the query:
- 530 K→N: Lossed enzymatic activity.
Query Sequence
>PfGW456L13_2428 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2428
MNMPIAQAVLNPVLDPLETASIDELRQHQLERLRWSLNHAYNNVPLYRQRFDALGVHPDD
IKSLDDLAKFPFTTKSDLRDNYPYGMFAVPMHDIVRLHASSGTTGKPTVVGYTQNDIDTW
ANVVARSIRAAGGHRGDKVHISYGYGLFTGGLGAHYGAERLGCTVIPMSGGQTEKQVQLI
KDFQPDIIMVTPSYMLNIADEIERQGIDPHKLALRLGIFGAEPWTAELRSAIEARMGITA
LDIYGLSEIMGPGVAMECAETKDGPTIWEDHFYPEIIDPVTGEVLPDGQMGELVFTSLSK
EALPMIRYRTRDLTRLLPGTARPMRRIDKITGRSDDMLIIRGVNVFPTQIEEQVLKVKQL
AECYEIHLYRNGNLDSVDVHVELKAEHQHLGDEQQKAVCGELSRHIKTYIGISSRIVLQP
FHSIKRSEGKACHVVDKRPKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory