SitesBLAST
Comparing PfGW456L13_2494 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2494 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
30% identity, 97% coverage: 1:378/390 of query aligns to 1:370/380 of 4l1fA
- active site: L125 (≠ F126), T126 (≠ S127), G242 (≠ A240), E363 (≠ L371)
- binding coenzyme a persulfide: T132 (≠ W132), H179 (≠ K179), F232 (≠ W230), M236 (≠ E234), E237 (≠ R235), L239 (= L237), D240 (≠ Q238), R243 (≠ C241), Y362 (≠ F370), E363 (≠ L371), G364 (= G372)
- binding flavin-adenine dinucleotide: F123 (≠ L124), L125 (≠ F126), T126 (≠ S127), G131 (= G131), T132 (≠ W132), F156 (≠ H156), I157 (≠ V157), T158 (≠ L158), R268 (= R266), Q270 (= Q268), F271 (= F269), I275 (= I273), F278 (= F276), L281 (= L279), Q336 (= Q344), I337 (≠ L345), G340 (= G348), I358 (≠ A366), Y362 (≠ F370), T365 (≠ L373), Q367 (≠ A375)
- binding 1,3-propandiol: L5 (≠ F5), Q10 (≠ E10)
Sites not aligning to the query:
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
29% identity, 99% coverage: 1:386/390 of query aligns to 1:377/379 of 1ukwB
- active site: L124 (≠ F126), S125 (= S127), T241 (≠ A240), E362 (≠ L371), R374 (≠ S383)
- binding cobalt (ii) ion: D145 (= D146), H146 (≠ G147)
- binding flavin-adenine dinucleotide: F122 (≠ L124), L124 (≠ F126), S125 (= S127), G130 (= G131), S131 (≠ W132), W155 (≠ H156), S157 (≠ L158), K200 (≠ Q203), L357 (≠ A366), Y361 (≠ F370), E362 (≠ L371), T364 (≠ L373), E366 (≠ A375), L370 (≠ E379)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
29% identity, 99% coverage: 1:386/390 of query aligns to 1:377/379 of 1ukwA
- active site: L124 (≠ F126), S125 (= S127), T241 (≠ A240), E362 (≠ L371), R374 (≠ S383)
- binding flavin-adenine dinucleotide: F122 (≠ L124), L124 (≠ F126), S125 (= S127), G130 (= G131), S131 (≠ W132), W155 (≠ H156), S157 (≠ L158), L357 (≠ A366), Y361 (≠ F370), E362 (≠ L371), T364 (≠ L373), E366 (≠ A375), L370 (≠ E379)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
29% identity, 85% coverage: 55:386/390 of query aligns to 51:377/378 of 5ol2F
- active site: L124 (≠ F126), T125 (≠ S127), G241 (≠ A240), G374 (≠ S383)
- binding coenzyme a persulfide: L238 (= L237), R242 (≠ C241), E362 (≠ L371), G363 (= G372)
- binding flavin-adenine dinucleotide: F122 (≠ L124), L124 (≠ F126), T125 (≠ S127), P127 (≠ A129), T131 (≠ W132), F155 (≠ H156), I156 (≠ V157), T157 (≠ L158), E198 (≠ P199), R267 (= R266), F270 (= F269), L274 (≠ I273), F277 (= F276), Q335 (= Q344), L336 (= L345), G338 (= G347), G339 (= G348), Y361 (≠ F370), T364 (≠ L373), E366 (≠ A375)
Sites not aligning to the query:
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
28% identity, 86% coverage: 53:386/390 of query aligns to 42:368/369 of 3pfdC
- active site: L116 (≠ F126), S117 (= S127), T233 (≠ A240), E353 (≠ L371), R365 (≠ S383)
- binding dihydroflavine-adenine dinucleotide: Y114 (≠ L124), L116 (≠ F126), S117 (= S127), G122 (= G131), S123 (≠ W132), W147 (≠ H156), I148 (≠ V157), T149 (≠ L158), R259 (= R266), F262 (= F269), V266 (≠ I273), N269 (≠ F276), Q326 (= Q344), L327 (= L345), G330 (= G348), I348 (≠ A366), Y352 (≠ F370), T355 (≠ L373), Q357 (≠ A375)
6wy8C Tcur3481-tcur3483 steroid acad (see paper)
30% identity, 99% coverage: 1:385/390 of query aligns to 1:358/364 of 6wy8C
7w0jE Acyl-coa dehydrogenase, tfu_1647
27% identity, 97% coverage: 9:386/390 of query aligns to 15:381/382 of 7w0jE
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: S127 (= S127), W157 (≠ H156), R270 (= R266), Q272 (= Q268), F273 (= F269), I277 (= I273), F280 (= F276), I283 (≠ L279), Q339 (= Q344), L340 (= L345), G343 (= G348), Y365 (≠ F370), E366 (≠ L371), T368 (≠ L373), Q370 (≠ A375), I371 (≠ W376)
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
27% identity, 97% coverage: 9:386/390 of query aligns to 14:380/381 of 8i4rA
- binding acetyl coenzyme *a: S132 (≠ W132), T134 (≠ A134), R180 (≠ K179), R234 (≠ S231), L237 (≠ E234), R238 (= R235), L240 (= L237), D241 (≠ Q238), R244 (≠ C241), E365 (≠ L371), G366 (= G372), R377 (≠ S383)
- binding flavin-adenine dinucleotide: Y123 (≠ L124), L125 (≠ F126), S126 (= S127), G131 (= G131), S132 (≠ W132), W156 (≠ H156), I157 (≠ V157), T158 (≠ L158), I360 (≠ A366), T367 (≠ L373), Q369 (≠ A375)
8i4pA Crystal structure of acyl-coa dehydrogenase from thermobifida fusca
27% identity, 97% coverage: 9:386/390 of query aligns to 14:380/381 of 8i4pA
- binding flavin-adenine dinucleotide: Y123 (≠ L124), L125 (≠ F126), S126 (= S127), G131 (= G131), S132 (≠ W132), W156 (≠ H156), I157 (≠ V157), T158 (≠ L158), I360 (≠ A366), Y364 (≠ F370), T367 (≠ L373), Q369 (≠ A375)
2z1qB Crystal structure of acyl coa dehydrogenase
27% identity, 87% coverage: 46:386/390 of query aligns to 63:409/549 of 2z1qB
- active site: L144 (≠ F126), T145 (≠ S127), G259 (≠ A240), E394 (≠ L371), G406 (≠ S383)
- binding flavin-adenine dinucleotide: Y142 (≠ L124), L144 (≠ F126), T145 (≠ S127), G150 (≠ W132), S151 (= S133), W177 (≠ H156), S179 (≠ L158), R285 (= R266), F288 (= F269), I292 (= I273), F295 (= F276), I298 (≠ L279), H369 (= H346), G370 (= G347), F393 (= F370), I399 (≠ W376)
Sites not aligning to the query:
3owaC Crystal structure of acyl-coa dehydrogenase complexed with fad from bacillus anthracis
26% identity, 96% coverage: 5:378/390 of query aligns to 23:405/587 of 3owaC
- active site: L143 (≠ F126), T144 (≠ S127), G258 (≠ A240), E398 (≠ L371)
- binding flavin-adenine dinucleotide: Y141 (≠ L124), L143 (≠ F126), T144 (≠ S127), G149 (≠ W132), S150 (= S133), W176 (≠ H156), I177 (≠ V157), T178 (≠ L158), R284 (= R266), F287 (= F269), I291 (= I273), F294 (= F276), Q371 (= Q344), I372 (≠ L345), G375 (= G348), I393 (≠ A366), F397 (= F370), T400 (≠ L373), E402 (≠ A375), I403 (≠ W376)
Sites not aligning to the query:
6wy9B Tcur3481-tcur3483 steroid acad g363a variant (see paper)
30% identity, 98% coverage: 5:385/390 of query aligns to 2:355/361 of 6wy9B
2jifA Structure of human short-branched chain acyl-coa dehydrogenase (acadsb)
26% identity, 99% coverage: 4:388/390 of query aligns to 5:380/381 of 2jifA
- active site: L125 (≠ A125), S126 (≠ F126), G242 (≠ A240), E363 (≠ L371), K375 (≠ S383)
- binding coenzyme a persulfide: S132 (≠ W132), S134 (≠ A134), Y178 (≠ E178), Y232 (≠ W230), I236 (≠ E234), L239 (= L237), N240 (≠ Q238), R243 (≠ C241), Y362 (≠ F370), E363 (≠ L371), G364 (= G372), I368 (≠ W376)
- binding flavin-adenine dinucleotide: F123 (≠ T123), L125 (≠ A125), S126 (≠ F126), G131 (= G131), S132 (≠ W132), W156 (≠ H156), I157 (≠ V157), S158 (≠ L158), K201 (≠ M201), T209 (≠ R209), R268 (= R266), F271 (= F269), L275 (≠ I273), F278 (= F276), L281 (= L279), E336 (≠ Q344), W337 (≠ L345), G340 (= G348), N367 (≠ A375), I368 (≠ W376)
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
25% identity, 98% coverage: 5:386/390 of query aligns to 3:377/379 of 6fahD
- active site: L124 (≠ F126), T125 (≠ S127), G241 (≠ A240), G374 (≠ S383)
- binding flavin-adenine dinucleotide: F122 (≠ L124), L124 (≠ F126), T125 (≠ S127), R152 (≠ T153), F155 (≠ H156), T157 (≠ L158), E198 (≠ R205), R267 (= R266), Q269 (= Q268), F270 (= F269), I274 (= I273), F277 (= F276), Q335 (= Q344), I336 (≠ L345), G339 (= G348), Y361 (≠ F370), T364 (≠ L373), Q366 (≠ A375)
P45954 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial; SBCAD; 2-methyl branched chain acyl-CoA dehydrogenase; 2-MEBCAD; 2-methylbutyryl-coenzyme A dehydrogenase; 2-methylbutyryl-CoA dehydrogenase; EC 1.3.8.5 from Homo sapiens (Human) (see 6 papers)
26% identity, 99% coverage: 4:388/390 of query aligns to 56:431/432 of P45954
- V137 (≠ T91) mutation to L: Decreased acyl-CoA dehydrogenase activity.
- F138 (≠ A92) mutation to L: Increased acyl-CoA dehydrogenase activity. No effect on substrate specificity.
- 174:183 (vs. 123:132, 10% identical) binding in other chain
- S183 (≠ W132) binding
- WIS 207:209 (≠ HVL 156:158) binding in other chain
- S210 (≠ D159) mutation to N: Increased acyl-CoA dehydrogenase activity. Changed substrate specificity.
- Y229 (≠ E178) binding
- L255 (≠ T204) to F: in SBCADD; loss of protein expression; loss of 2-methylbutyryl-CoA dehydrogenase activity; dbSNP:rs137852649
- Y283 (≠ W230) binding
- NEGR 291:294 (≠ QLAC 238:241) binding
- I316 (≠ M263) to V: in dbSNP:rs1131430
- R319 (= R266) binding
- Q330 (= Q277) binding
- EWMGG 387:391 (≠ QLHGG 344:348) binding
- A416 (≠ L373) mutation to T: Increased acyl-CoA dehydrogenase activity. No effect on substrate specificity.
- ASN 416:418 (≠ LPA 373:375) binding in other chain
Sites not aligning to the query:
- 1:33 modified: transit peptide, Mitochondrion
- 13 R → K: in dbSNP:rs12263012
7p9xA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1-ene-1-carboxyl-coa (see paper)
28% identity, 82% coverage: 58:378/390 of query aligns to 52:368/378 of 7p9xA
- binding 1-monoenoyl-CoA: L82 (≠ A98), D89 (= D105), S129 (≠ W132), L131 (≠ A134), K176 (= K179), F229 (≠ W230), M233 (≠ E234), L236 (= L237), R240 (≠ C241), Y360 (≠ F370), T361 (≠ L371), G362 (= G372)
- binding flavin-adenine dinucleotide: A122 (= A125), T123 (≠ F126), G128 (= G131), S129 (≠ W132), F153 (≠ H156), I154 (≠ V157), T155 (≠ L158), N206 (vs. gap), L356 (≠ A366), Y360 (≠ F370), T363 (≠ L373), Q365 (≠ A375), I366 (≠ W376)
Sites not aligning to the query:
7p9aA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1,5-diene-1-carboxyl-coa (see paper)
28% identity, 82% coverage: 58:378/390 of query aligns to 54:370/380 of 7p9aA
- binding 1,5 Dienoyl-CoA: S131 (≠ W132), L133 (≠ A134), K178 (= K179), F231 (≠ W230), M235 (≠ E234), L238 (= L237), N241 (≠ A240), R242 (≠ C241), Y362 (≠ F370), T363 (≠ L371), G364 (= G372)
- binding flavin-adenine dinucleotide: L122 (≠ T123), A124 (= A125), T125 (≠ F126), G130 (= G131), S131 (≠ W132), F155 (≠ H156), I156 (≠ V157), T157 (≠ L158), K200 (≠ R209), N208 (vs. gap), L358 (≠ A366), T365 (≠ L373), Q367 (≠ A375), I368 (≠ W376)
Sites not aligning to the query:
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 85% coverage: 55:386/390 of query aligns to 81:407/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
27% identity, 85% coverage: 55:386/390 of query aligns to 54:380/384 of 1jqiA
- active site: G377 (≠ S383)
- binding acetoacetyl-coenzyme a: L95 (≠ M94), F125 (≠ L124), S134 (≠ W132), F234 (≠ W230), M238 (≠ E234), Q239 (≠ R235), L241 (= L237), D242 (≠ Q238), R245 (≠ C241), Y364 (≠ F370), E365 (≠ L371), G366 (= G372)
- binding flavin-adenine dinucleotide: F125 (≠ L124), L127 (≠ F126), S128 (= S127), G133 (= G131), S134 (≠ W132), W158 (≠ H156), T160 (≠ L158), R270 (= R266), F273 (= F269), L280 (≠ F276), Q338 (= Q344), I339 (≠ L345), G342 (= G348), I360 (≠ A366), T367 (≠ L373), E369 (≠ A375), I370 (≠ W376)
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
27% identity, 85% coverage: 55:386/390 of query aligns to 54:380/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (≠ V349), T347 (≠ W353), E348 (= E354)
- binding flavin-adenine dinucleotide: F125 (≠ L124), L127 (≠ F126), S128 (= S127), G133 (= G131), S134 (≠ W132), W158 (≠ H156), T160 (≠ L158), R270 (= R266), F273 (= F269), L280 (≠ F276), V282 (≠ A278), Q338 (= Q344), I339 (≠ L345), G342 (= G348), I360 (≠ A366), Y364 (≠ F370), T367 (≠ L373), E369 (≠ A375), I370 (≠ W376), L373 (≠ E379)
Query Sequence
>PfGW456L13_2494 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2494
MEFAFSDEQEMIRASAEGFLADVSDSAAVRAAMVSERGFDEALWQRLCQEMYWPAIHIPE
TYGGLGLGFVELTILLEQMGRRLLCSPFFATACMATPALLLAANDQQKQRWLPSIADGSV
TATLAFSSANGWSADDVQATVVAEGDGYVLDGTLKHVLDGHGADLLIIAARQPGTTGEKG
ISLFAMSAERAGIERQMLPTMDQTRRQARIQLKGLYLEADCLLGEFGNGWSHLERVLQLA
CIGLAAEQTGGAQQVLDLSVAYMQERQQFGRPIASFQALKHRAADMMLQVECARSASYYA
ACVAQEVLDPQGDPQVAAELPLAAALAKAQCSETYFSCASESIQLHGGVGFTWEYDPHLY
FKRARASESFLGLPAWHRERIASVILGEQP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory