SitesBLAST
Comparing PfGW456L13_2495 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P96855 Acyl-CoA dehydrogenase FadE34; ACAD; 3-oxochol-4-en-24-oyl-CoA dehydrogenase; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 88% coverage: 43:391/397 of query aligns to 379:711/711 of P96855
- E581 (= E251) mutation to Q: Displays less than 1% activity with cholyl-CoA as substrate. Still binds FAD.
Sites not aligning to the query:
- 236 R→A: Displays less than 2% activity with cholyl-CoA as substrate. Cannot bind FAD.
I6YCA3 Acyl-CoA dehydrogenase FadE26; ACAD; 3-oxocholest-4-en-26-oyl-CoA dehydrogenase alpha subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 99% coverage: 1:394/397 of query aligns to 1:400/400 of I6YCA3
- IGYS 127:130 (≠ QGYS 131:134) binding
- T136 (≠ S140) binding
- S162 (= S168) binding
- E247 (= E251) mutation to A: Loss of dehydrogenase activity.
- TNE 380:382 (≠ SNE 374:376) binding
4x28A Crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis (see paper)
32% identity, 98% coverage: 1:391/397 of query aligns to 1:384/386 of 4x28A
- active site: Y122 (= Y133), S123 (= S134), E240 (= E251), G365 (= G372), M377 (≠ E384)
- binding dihydroflavine-adenine dinucleotide: I120 (≠ Q131), Y122 (= Y133), S123 (= S134), G128 (= G139), T129 (≠ S140), W153 (= W166), S155 (= S168), F363 (≠ L370), T367 (≠ S374), E369 (= E376), V370 (≠ I377)
6wy9A Tcur3481-tcur3483 steroid acad g363a variant (see paper)
32% identity, 86% coverage: 52:391/397 of query aligns to 43:379/380 of 6wy9A
- active site: Y122 (= Y133), T123 (≠ S134), E237 (= E251), T372 (≠ E384)
- binding dihydroflavine-adenine dinucleotide: I120 (≠ Q131), Y122 (= Y133), T123 (≠ S134), G128 (= G139), T129 (≠ S140), F153 (≠ W166), S155 (= S168), F358 (≠ L370), V362 (≠ S374), E364 (= E376)
6wy8B Tcur3481-tcur3483 steroid acad (see paper)
32% identity, 86% coverage: 52:391/397 of query aligns to 47:383/384 of 6wy8B
- active site: Y126 (= Y133), T127 (≠ S134), E241 (= E251), T376 (≠ E384)
- binding flavin-adenine dinucleotide: I124 (≠ Q131), Y126 (= Y133), T127 (≠ S134), G132 (= G139), T133 (≠ S140), F157 (≠ W166), S159 (= S168), V359 (≠ A367), F362 (≠ L370), G363 (≠ Y371), V366 (≠ S374), E368 (= E376)
P71858 Acyl-CoA dehydrogenase FadE29; ACAD; 3-oxo-23,24-bisnorchol-4-en-22-oyl-CoA dehydrogenase beta subunit; 3-oxo-4-pregnene-20-carboxyl-CoA dehydrogenase beta subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 99% coverage: 1:394/397 of query aligns to 1:387/387 of P71858
- E241 (= E251) mutation to Q: Unable to dehydrogenate pregnene-carboxyl-CoA ester.
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
28% identity, 84% coverage: 53:385/397 of query aligns to 44:377/380 of 2pg0A
- active site: M124 (≠ Y133), T125 (≠ S134), E243 (= E251), A364 (≠ G372), R376 (≠ E384)
- binding flavin-adenine dinucleotide: I122 (≠ Q131), M124 (≠ Y133), T125 (≠ S134), G130 (= G139), S131 (= S140), F155 (≠ W166), I156 (≠ T167), T157 (≠ S168), R269 (≠ K275), F272 (≠ G278), F279 (vs. gap), Q337 (≠ D339), L338 (≠ V340), G340 (= G342), G341 (≠ A343), V359 (≠ A367), I362 (≠ L370), Y363 (= Y371), T366 (≠ S374), E368 (= E376), M369 (≠ I377)
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
29% identity, 87% coverage: 43:387/397 of query aligns to 29:367/369 of 3pfdC
- active site: L116 (≠ Y133), S117 (= S134), T233 (≠ E251), E353 (≠ G372), R365 (= R385)
- binding dihydroflavine-adenine dinucleotide: Y114 (≠ Q131), L116 (≠ Y133), S117 (= S134), G122 (= G139), S123 (= S140), W147 (= W166), I148 (≠ T167), T149 (≠ S168), R259 (≠ N277), F262 (≠ D280), V266 (≠ I284), N269 (≠ Q287), Q326 (≠ E346), L327 (= L347), G330 (≠ A350), I348 (≠ A367), Y352 (= Y371), T355 (≠ S374), Q357 (≠ E376)
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
29% identity, 87% coverage: 40:383/397 of query aligns to 33:373/381 of 8sgsA
- binding coenzyme a: S131 (= S140), A133 (vs. gap), N177 (≠ H189), F231 (≠ W241), M235 (= M245), L238 (= L248), I312 (≠ R316), E362 (≠ G372), G363 (= G373)
- binding flavin-adenine dinucleotide: F122 (≠ Q131), L124 (≠ Y133), S125 (= S134), G130 (= G139), S131 (= S140), W155 (= W166), T157 (≠ S168), R267 (≠ N277), F270 (≠ D280), L274 (≠ I284), L277 (≠ Q287), Q335 (≠ D339), I336 (≠ V340), G338 (= G342), G339 (≠ A343), I357 (≠ A367), I360 (≠ L370), Y361 (= Y371), T364 (≠ S374), E366 (= E376)
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
29% identity, 87% coverage: 40:383/397 of query aligns to 36:376/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (≠ E344), T347 (≠ L348), E348 (= E349)
- binding flavin-adenine dinucleotide: F125 (≠ Q131), L127 (≠ Y133), S128 (= S134), G133 (= G139), S134 (= S140), W158 (= W166), T160 (≠ S168), R270 (≠ N277), F273 (≠ D280), L280 (≠ Q287), V282 (≠ L289), Q338 (≠ D339), I339 (≠ V340), G342 (≠ A343), I360 (≠ A367), Y364 (= Y371), T367 (≠ S374), E369 (= E376), I370 (= I377), L373 (≠ N380)
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
29% identity, 87% coverage: 40:383/397 of query aligns to 39:379/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (≠ Q131), L130 (≠ Y133), S131 (= S134), G136 (= G139), S137 (= S140), W161 (= W166), T163 (≠ S168), T214 (≠ F218), R273 (≠ N277), F276 (≠ D280), L280 (≠ I284), L283 (≠ Q287), V285 (≠ L289), Q341 (≠ D339), I342 (≠ V340), G345 (≠ A343), I363 (≠ A367), Y367 (= Y371), T370 (≠ S374), E372 (= E376), L376 (≠ N380)
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
29% identity, 87% coverage: 40:383/397 of query aligns to 63:403/412 of P16219
- G90 (= G70) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (= E84) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 131:140, 60% identical) binding in other chain
- R171 (= R148) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ WTS 166:168) binding in other chain
- A192 (≠ S173) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (= G191) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (≠ N277) binding
- Q308 (≠ R288) binding in other chain
- R325 (= R305) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (= S327) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ DVLGA 339:343) binding
- R380 (≠ S360) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
- TSE 394:396 (≠ SNE 374:376) binding in other chain
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
8hk0B Crystal structure of fic32-33 complex from streptomyces ficellus nrrl 8067 (see paper)
31% identity, 63% coverage: 1:252/397 of query aligns to 1:244/379 of 8hk0B
Sites not aligning to the query:
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
28% identity, 87% coverage: 40:383/397 of query aligns to 36:376/384 of 1jqiA
- binding acetoacetyl-coenzyme a: L95 (= L101), F125 (≠ Q131), S134 (= S140), F234 (≠ W241), M238 (= M245), Q239 (≠ A246), L241 (= L248), D242 (≠ G249), R245 (= R252), Y364 (= Y371), E365 (≠ G372), G366 (= G373)
- binding flavin-adenine dinucleotide: F125 (≠ Q131), L127 (≠ Y133), S128 (= S134), G133 (= G139), S134 (= S140), W158 (= W166), T160 (≠ S168), R270 (≠ N277), F273 (≠ D280), L280 (vs. gap), Q338 (≠ D339), I339 (≠ V340), G342 (≠ A343), I360 (≠ A367), T367 (≠ S374), E369 (= E376), I370 (= I377)
Sites not aligning to the query:
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 87% coverage: 40:383/397 of query aligns to 63:403/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
2vigB Crystal structure of human short-chain acyl coa dehydrogenase
29% identity, 87% coverage: 40:383/397 of query aligns to 30:363/371 of 2vigB
- active site: L121 (≠ Y133), S122 (= S134), G231 (≠ E251), E352 (≠ G372)
- binding coenzyme a persulfide: S128 (= S140), F221 (≠ W241), M225 (= M245), Q226 (≠ A246), L228 (= L248), D229 (≠ G249), R232 (= R252), E352 (≠ G372), G353 (= G373), I357 (= I377)
- binding flavin-adenine dinucleotide: L121 (≠ Y133), S122 (= S134), G127 (= G139), S128 (= S140), W152 (= W166), T154 (≠ S168), R257 (≠ N277), F260 (≠ D280), L264 (≠ I284), L267 (≠ Q287), Q325 (≠ D339), I326 (≠ V340), G329 (≠ A343), I347 (≠ A367), Y351 (= Y371), T354 (≠ S374), E356 (= E376)
Sites not aligning to the query:
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
29% identity, 85% coverage: 53:388/397 of query aligns to 44:378/379 of 1ukwB
- active site: L124 (≠ Y133), S125 (= S134), T241 (≠ E251), E362 (≠ G372), R374 (≠ E384)
- binding cobalt (ii) ion: D145 (≠ G156), H146 (≠ S157)
- binding flavin-adenine dinucleotide: F122 (≠ Q131), L124 (≠ Y133), S125 (= S134), G130 (= G139), S131 (= S140), W155 (= W166), S157 (= S168), K200 (≠ L212), L357 (= L361), Y361 (= Y371), E362 (≠ G372), T364 (≠ S374), E366 (= E376), L370 (≠ N380)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
29% identity, 85% coverage: 53:388/397 of query aligns to 44:378/379 of 1ukwA
- active site: L124 (≠ Y133), S125 (= S134), T241 (≠ E251), E362 (≠ G372), R374 (≠ E384)
- binding flavin-adenine dinucleotide: F122 (≠ Q131), L124 (≠ Y133), S125 (= S134), G130 (= G139), S131 (= S140), W155 (= W166), S157 (= S168), L357 (= L361), Y361 (= Y371), E362 (≠ G372), T364 (≠ S374), E366 (= E376), L370 (≠ N380)
5iduC Crystal structure of an acyl-coa dehydrogenase domain protein from burkholderia phymatum bound to fad
29% identity, 83% coverage: 52:382/397 of query aligns to 61:391/405 of 5iduC
- active site: L145 (≠ Y133), S146 (= S134), F260 (vs. gap), E381 (≠ G372)
- binding flavin-adenine dinucleotide: F143 (≠ Q131), L145 (≠ Y133), S146 (= S134), G151 (= G139), S152 (= S140), W176 (= W166), S178 (= S168), R286 (≠ Q260), M288 (≠ Q262), F296 (≠ I271), Q354 (≠ E346), L355 (= L347), G358 (≠ A350), A376 (= A367), Y380 (= Y371), A383 (≠ S374), E385 (= E376)
Sites not aligning to the query:
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
27% identity, 85% coverage: 50:387/397 of query aligns to 37:377/380 of 4l1fA
- active site: L125 (≠ Y133), T126 (≠ S134), G242 (≠ E251), E363 (≠ G372), R375 (= R385)
- binding coenzyme a persulfide: T132 (≠ S140), H179 (≠ R190), F232 (≠ W241), M236 (= M245), E237 (≠ A246), L239 (= L248), D240 (≠ G249), R243 (= R252), Y362 (= Y371), E363 (≠ G372), G364 (= G373), R375 (= R385)
- binding flavin-adenine dinucleotide: F123 (≠ Q131), L125 (≠ Y133), T126 (≠ S134), G131 (= G139), T132 (≠ S140), F156 (≠ W166), I157 (≠ T167), T158 (≠ S168), R268 (≠ A290), Q270 (≠ A292), F271 (≠ W293), I275 (= I298), F278 (≠ Y301), L281 (= L304), Q336 (≠ E346), I337 (≠ L347), G340 (≠ A350), I358 (≠ A367), Y362 (= Y371), T365 (≠ S374), Q367 (≠ E376)
Sites not aligning to the query:
Query Sequence
>PfGW456L13_2495 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2495
MKISFSEQDERFRREVADWMSANLCGEFEALRFRGGPGDEHMFPEERKAWERKLAEGGWT
CVGWAPEHGGRGLSITQQVIFNEEYARAGGPGRMGHIGEGLAGPTIAAFGTVEQQQRFLP
GIVSGTSFWCQGYSEPGAGSDLASVKTRATLDEATGSWIINGQKVWTSLAHESDWCFVIA
RTEPGSVGHRGLSFLLVPMAQTEITVRPIEQLTGTSEFNEVFFDDARTDATNIIGAPGEG
WKIAMALLGFERGVSTLGQQMQFQNELNEIIAIAKTNGADRDPILRQRLAEAWSGLRIMR
YNSLRMLSGSQDGSLRKEATIYKLFWSTWHASLGKLAMDVLGAEAELLEAAPYQLTRLQS
LYLFSRADTLYGGSNEIQRNIIAERALGMPKEPRPRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory