SitesBLAST
Comparing PfGW456L13_2522 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2522 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
41% identity, 96% coverage: 3:239/248 of query aligns to 2:243/251 of 6xewA
- active site: G16 (= G17), S138 (= S132), Y151 (= Y145)
- binding r,3-hydroxybutan-2-one: S138 (= S132), S140 (≠ F134), Y151 (= Y145)
- binding s,3-hydroxybutan-2-one: S138 (= S132), Y151 (= Y145), S182 (≠ G176)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ S16), G16 (= G17), M17 (≠ I18), D36 (= D37), W37 (vs. gap), W37 (vs. gap), A38 (vs. gap), I59 (≠ L52), D60 (= D53), V61 (= V54), N87 (≠ A80), A88 (= A81), G89 (= G82), V110 (≠ I103), T136 (≠ V130), S138 (= S132), Y151 (= Y145), K155 (= K149), S182 (≠ G176), L183 (= L177), V184 (≠ I178), T186 (= T180), N187 (≠ P181), M188 (= M182), T189 (= T183)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
41% identity, 96% coverage: 3:239/248 of query aligns to 4:245/252 of 6vspB
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
41% identity, 96% coverage: 3:239/248 of query aligns to 2:243/251 of 6vspA
- active site: G16 (= G17), S138 (= S132), Y151 (= Y145)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), N15 (≠ S16), G16 (= G17), M17 (≠ I18), D36 (= D37), W37 (vs. gap), W37 (vs. gap), A38 (vs. gap), I59 (≠ L52), D60 (= D53), V61 (= V54), N87 (≠ A80), A88 (= A81), G89 (= G82), V90 (= V83), V110 (≠ I103), T136 (≠ V130), S138 (= S132), Y151 (= Y145), K155 (= K149), P181 (= P175), S182 (≠ G176), L183 (= L177), V184 (≠ I178), T186 (= T180), N187 (≠ P181), M188 (= M182), T189 (= T183)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
41% identity, 96% coverage: 3:239/248 of query aligns to 2:243/251 of H9XP47
- N15 (≠ S16) binding
- M17 (≠ I18) binding
- D36 (= D37) binding
- D60 (= D53) binding
- V61 (= V54) binding
- N87 (≠ A80) binding
- S138 (= S132) binding ; binding
- V139 (≠ I133) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ F134) binding
- Y151 (= Y145) binding ; binding ; binding
- K155 (= K149) binding
- V184 (≠ I178) binding
- T186 (= T180) binding
- RDK 197:199 (≠ RDN 187:189) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
40% identity, 95% coverage: 4:239/248 of query aligns to 5:254/255 of 5itvA
- active site: G18 (= G17), S141 (= S132), Y154 (= Y145), K158 (= K149)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (= S16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (= I38), T61 (≠ L52), I63 (≠ V54), N89 (≠ A80), G91 (= G82), T139 (≠ V130), S141 (= S132), Y154 (= Y145), K158 (= K149), P184 (= P175), G185 (= G176), I186 (≠ L177), I187 (= I178)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
42% identity, 96% coverage: 3:239/248 of query aligns to 7:252/258 of 4wecA
- active site: G21 (= G17), S143 (= S132), Q154 (≠ N142), Y157 (= Y145), K161 (= K149)
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), A19 (= A15), S20 (= S16), G21 (= G17), I22 (= I18), D41 (= D37), I42 (= I38), V61 (≠ L52), D62 (= D53), V63 (= V54), N89 (≠ A80), T141 (≠ V130), Y157 (= Y145), K161 (= K149), P187 (= P175), P189 (≠ L177), V190 (≠ I178)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
42% identity, 95% coverage: 3:237/248 of query aligns to 2:237/239 of 4nbtA
- active site: G16 (= G17), S132 (= S132), Y145 (= Y145), K149 (= K149)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), K15 (≠ S16), G16 (= G17), L17 (≠ I18), D36 (= D37), L37 (≠ I38), L52 (= L52), N53 (≠ D53), V54 (= V54), N80 (≠ A80), A81 (= A81), G82 (= G82), I130 (≠ V130), S132 (= S132), Y145 (= Y145), K149 (= K149), P177 (= P175), G178 (= G176), I180 (= I178), T182 (= T180)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
39% identity, 95% coverage: 4:239/248 of query aligns to 5:226/227 of 5itvD
- active site: G18 (= G17), S141 (= S132), Y154 (= Y145), K158 (= K149)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (= S16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (= I38), T61 (≠ L52), D62 (= D53), I63 (≠ V54), N89 (≠ A80), T139 (≠ V130), S141 (= S132), Y154 (= Y145), K158 (= K149), P184 (= P175), G185 (= G176), I187 (= I178)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 96% coverage: 1:237/248 of query aligns to 2:242/244 of 4nbuB
- active site: G18 (= G17), N111 (= N104), S139 (= S132), Q149 (≠ N142), Y152 (= Y145), K156 (= K149)
- binding acetoacetyl-coenzyme a: D93 (≠ Q86), K98 (≠ Q91), S139 (= S132), N146 (≠ C139), V147 (≠ D140), Q149 (≠ N142), Y152 (= Y145), F184 (≠ L177), M189 (= M182), K200 (≠ F195)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ I38), V59 (≠ L52), D60 (= D53), V61 (= V54), N87 (≠ A80), A88 (= A81), G89 (= G82), I90 (≠ V83), T137 (≠ V130), S139 (= S132), Y152 (= Y145), K156 (= K149), P182 (= P175), F184 (≠ L177), T185 (≠ I178), T187 (= T180), M189 (= M182)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
41% identity, 94% coverage: 7:239/248 of query aligns to 6:238/240 of 2d1yA
- active site: G16 (= G17), S135 (= S132), N145 (= N142), Y148 (= Y145), K152 (= K149)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (≠ S16), I17 (= I18), D36 (= D37), L37 (≠ I38), R38 (vs. gap), V55 (≠ L52), D56 (= D53), L57 (≠ V54), N83 (≠ A80), A84 (= A81), A85 (≠ G82), I86 (≠ V83), V133 (= V130), S135 (= S132), Y148 (= Y145), K152 (= K149), P178 (= P175), G179 (= G176), I181 (= I178), T183 (= T180), A185 (vs. gap), V186 (vs. gap)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 96% coverage: 3:240/248 of query aligns to 3:240/244 of 1nfqA
- active site: G17 (= G17), S139 (= S132), Y152 (= Y145), K156 (= K149)
- binding Androsterone: L91 (≠ A84), E141 (≠ F134), C149 (≠ N142), Y152 (= Y145), V193 (= V186), I197 (≠ A191), F198 (= F192)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ S16), G17 (= G17), M18 (≠ I18), D37 (= D37), L39 (≠ G39), L59 (= L52), D60 (= D53), V61 (= V54), N87 (≠ A80), A88 (= A81), I137 (≠ V130), S139 (= S132), Y152 (= Y145), K156 (= K149), P182 (= P175), V185 (≠ I178), T187 (= T180), P188 (= P181), M189 (= M182), T190 (= T183)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 96% coverage: 3:240/248 of query aligns to 3:240/244 of 1nffA
- active site: G17 (= G17), S139 (= S132), Y152 (= Y145), K156 (= K149)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), R16 (≠ S16), G17 (= G17), M18 (≠ I18), D37 (= D37), I38 (= I38), L39 (≠ G39), L59 (= L52), D60 (= D53), V61 (= V54), N87 (≠ A80), A88 (= A81), G89 (= G82), I90 (≠ V83), I137 (≠ V130), S139 (= S132), Y152 (= Y145), K156 (= K149), P182 (= P175), V185 (≠ I178), T187 (= T180), P188 (= P181), M189 (= M182), T190 (= T183)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 96% coverage: 3:240/248 of query aligns to 4:241/260 of P9WGT1
- I6 (≠ Q5) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ SGI 16:18) binding
- D38 (= D37) binding
- V47 (≠ P46) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (= DV 53:54) binding
- T69 (≠ Q61) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (≠ A80) binding
- S140 (= S132) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y145) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K149) binding
- 183:191 (vs. 175:183, 78% identical) binding
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
35% identity, 95% coverage: 4:238/248 of query aligns to 5:246/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
35% identity, 95% coverage: 4:238/248 of query aligns to 5:246/255 of 2dteA
- active site: G18 (= G17), S132 (= S132), Y145 (= Y145), S148 (= S148), K149 (= K149)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S16 (≠ A15), M17 (≠ S16), G18 (= G17), I19 (= I18), S38 (≠ D37), I39 (= I38), C52 (≠ L52), D53 (= D53), V54 (= V54), N80 (≠ A80), A81 (= A81), I130 (≠ V130), S132 (= S132), Y145 (= Y145), K149 (= K149), P174 (= P175), A175 (≠ G176), T176 (≠ L177), I177 (= I178), T179 (= T180), P180 (= P181), L181 (≠ M182), V182 (≠ T183)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
36% identity, 95% coverage: 4:238/248 of query aligns to 2:243/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), M16 (≠ I18), D35 (= D37), I36 (= I38), I62 (≠ V54), N88 (≠ A80), G90 (= G82), I138 (≠ V130), S140 (= S132), Y152 (= Y145), K156 (= K149), I185 (= I178)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
36% identity, 95% coverage: 4:238/248 of query aligns to 3:244/248 of Q9KJF1
- S15 (= S16) binding
- D36 (= D37) binding
- D62 (= D53) binding
- I63 (≠ V54) binding
- N89 (≠ A80) binding
- Y153 (= Y145) binding
- K157 (= K149) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7xqmB Indel-mutant short chain dehydrogenase bound to sah (see paper)
40% identity, 96% coverage: 1:239/248 of query aligns to 1:244/253 of 7xqmB
- binding s-adenosyl-l-homocysteine: G13 (= G13), I16 (= I18), D34 (= D37), L35 (≠ I38), R36 (vs. gap), V53 (≠ L52), L55 (≠ V54), N81 (≠ A80), A82 (= A81), A83 (≠ G82), Y146 (= Y145)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
35% identity, 95% coverage: 4:239/248 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G17), S142 (= S132), Y155 (= Y145), K159 (= K149)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (= S16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (= I38), A61 (≠ L52), D62 (= D53), T63 (≠ V54), N89 (≠ A80), A90 (= A81), M140 (≠ V130), S142 (= S132), Y155 (= Y145), K159 (= K149), P185 (= P175), A186 (≠ G176), Y187 (≠ L177), I188 (= I178), L192 (vs. gap)
5jc8D Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
37% identity, 96% coverage: 3:239/248 of query aligns to 3:259/262 of 5jc8D
Query Sequence
>PfGW456L13_2522 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2522
MARLQNKVAVVTGGASGIGLACVRRFSAEGAQVIGLDIGSAPADFPGLFMTLDVRDEAQV
QQVMQEVISRFGRIDVLVNAAGVADQGSVTQTTTANWQRVMDINLTGSMLTSKYALASMV
EQRNGSIINVGSIFGLQGCDGNVAYNVSKGGINQLTRSMAIDYGYANIRVNGLCPGLIET
PMTSMVRDNDAFHAFFASQHMLNRSGQPEEVANVALFLASDEASFVSGQMIAVDGGFSAG
RRFAPPAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory