SitesBLAST
Comparing PfGW456L13_2523 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2523 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
34% identity, 78% coverage: 67:345/360 of query aligns to 486:739/753 of 6laaA
- binding fe2/s2 (inorganic) cluster: S700 (= S305), C702 (= C307), E703 (= E308), G705 (= G310), C707 (= C312), G708 (= G313), C710 (= C315)
- binding flavin mononucleotide: R487 (= R68), Q488 (≠ C69), Y489 (= Y70), S490 (= S71), Q506 (≠ K87), S511 (≠ G92), R512 (= R93), G514 (vs. gap), S515 (= S95), I553 (≠ S135), E651 (= E243), F653 (= F245)
Sites not aligning to the query:
- active site: 177, 251, 252, 359, 360, 361
- binding carbonate ion: 90, 91, 92, 241
- binding fe2/s2 (inorganic) cluster: 740
- binding protoporphyrin ix containing fe: 54, 91, 92, 99, 103, 249, 252, 253, 298, 351, 352, 353, 357, 359, 361
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
32% identity, 55% coverage: 48:245/360 of query aligns to 184:396/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R68), Q207 (≠ C69), Y208 (= Y70), S209 (= S71), S222 (≠ T85), V223 (= V86), K224 (= K87), E226 (≠ V89), P232 (vs. gap), G234 (vs. gap), Y235 (≠ R93), V236 (= V94), S237 (= S95), V276 (≠ S135), T279 (= T138), V395 (≠ R244), F396 (= F245)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
32% identity, 55% coverage: 48:245/360 of query aligns to 184:396/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R68), Q207 (≠ C69), Y208 (= Y70), S209 (= S71), S222 (≠ T85), V223 (= V86), K224 (= K87), E226 (≠ V89), P232 (vs. gap), G234 (vs. gap), Y235 (≠ R93), V236 (= V94), S237 (= S95), V276 (≠ S135), T279 (= T138), F396 (= F245)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
32% identity, 55% coverage: 48:245/360 of query aligns to 184:396/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R68), Q207 (≠ C69), Y208 (= Y70), S209 (= S71), S222 (≠ T85), V223 (= V86), K224 (= K87), E226 (≠ V89), P232 (vs. gap), G234 (vs. gap), Y235 (≠ R93), V236 (= V94), S237 (= S95), E394 (= E243), V395 (≠ R244)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 397, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102, 122, 125, 126
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
32% identity, 55% coverage: 48:245/360 of query aligns to 184:396/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
32% identity, 55% coverage: 48:245/360 of query aligns to 184:396/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (≠ F54), R206 (= R68), Q207 (≠ C69), Y208 (= Y70), S209 (= S71), S222 (≠ T85), E226 (≠ V89), Q231 (vs. gap), P232 (vs. gap), G234 (vs. gap), Y235 (≠ R93), V236 (= V94), S237 (= S95), V395 (≠ R244)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 397, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
6kbhA Crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase
32% identity, 81% coverage: 66:358/360 of query aligns to 497:765/765 of 6kbhA
- binding fe2/s2 (inorganic) cluster: C714 (= C307), E715 (= E308), G717 (= G310), C719 (= C312), G720 (= G313), C722 (= C315), C752 (= C345)
- binding flavin mononucleotide: R499 (= R68), Q500 (≠ C69), Y501 (= Y70), S502 (= S71), A516 (≠ T85), L518 (vs. gap), S523 (≠ V89), R524 (≠ D90), G526 (= G92), S527 (= S95), I565 (≠ S135), T568 (= T138), E663 (= E243), F665 (= F245), I718 (≠ F311)
Sites not aligning to the query:
- active site: 190, 264, 265, 372, 373, 374
- binding protoporphyrin ix containing fe: 67, 104, 105, 112, 116, 261, 262, 265, 266, 308, 311, 313, 364, 365, 370, 372, 373, 374, 378
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
31% identity, 55% coverage: 49:245/360 of query aligns to 34:235/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (≠ F54), R55 (= R68), Q56 (≠ C69), Y57 (= Y70), S58 (= S71), S71 (≠ T85), V72 (= V86), E75 (≠ V89), N81 (≠ D90), G83 (= G92), L84 (≠ R93), V85 (= V94), S86 (= S95), T127 (= T138), E233 (= E243), F235 (= F245)
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
26% identity, 86% coverage: 49:356/360 of query aligns to 39:319/321 of 2piaA
- binding fe2/s2 (inorganic) cluster: S270 (= S305), C272 (= C307), E273 (= E308), G275 (= G310), C277 (= C312), G278 (= G313), C280 (= C315), C308 (= C345)
- binding flavin mononucleotide: N44 (≠ F54), R55 (= R68), T56 (≠ C69), Y57 (= Y70), S58 (= S71), A72 (≠ T85), V73 (= V86), G79 (= G92), R80 (= R93), G82 (≠ S95), S83 (≠ N96), I121 (≠ S135), T124 (= T138), E223 (= E243), F225 (= F245)
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
25% identity, 86% coverage: 49:356/360 of query aligns to 40:320/322 of P33164
5ylyB Crystal structure of the cytochrome b5 reductase domain of ulva prolifera nitrate reductase (see paper)
32% identity, 37% coverage: 90:223/360 of query aligns to 96:247/269 of 5ylyB
Sites not aligning to the query:
1cnfA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
30% identity, 45% coverage: 63:223/360 of query aligns to 47:238/260 of 1cnfA
- active site: Y54 (= Y70), T55 (≠ S71), C232 (= C217)
- binding adenosine-5'-diphosphate: K71 (= K83), N165 (= N161), P234 (= P219), P236 (= P221), M237 (≠ F222)
- binding flavin-adenine dinucleotide: R52 (= R68), A53 (≠ C69), Y54 (= Y70), L69 (= L81), Y73 (≠ T85), F81 (vs. gap), G84 (= G91), G85 (= G92), L86 (≠ R93), M87 (≠ V94), T88 (≠ S95), S136 (= S135), T139 (= T138), P140 (= P139)
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
28% identity, 65% coverage: 13:246/360 of query aligns to 95:330/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (≠ F54), R144 (= R68), Q145 (≠ C69), Y146 (= Y70), S147 (= S71), H161 (≠ T85), V162 (= V86), V165 (= V89), G168 (= G92), V169 (≠ R93), A170 (≠ V94), T171 (≠ S95), T214 (≠ S135), F329 (= F245)
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
28% identity, 65% coverage: 13:246/360 of query aligns to 96:331/334 of P0DPQ8
Sites not aligning to the query:
- 35 binding
- 40 binding
- 43 binding
- 75 binding
- 334 binding
A0A286R227 Nitrate reductase [NADH]; NR; EC 1.7.1.1 from Ulva prolifera (Green seaweed) (Enteromorpha prolifera) (see paper)
32% identity, 37% coverage: 90:223/360 of query aligns to 690:841/863 of A0A286R227
- KFS 693:695 (≠ RVS 93:95) binding
- T746 (= T138) binding
- C835 (= C217) mutation to A: Loss of enzyme activity to 21% of that of the wild-type, but increased affinity for NADH.
Sites not aligning to the query:
- 640 H→A: Minimal effect in enzyme activity and a minor change in affinity for NADH.
- 659 R→A: Loss of enzyme activity to 13% of that of the wild-type and decreased affinity for NADH.
- 659:662 binding
- 662 T→A: Loss of enzyme activity to 18% of that of the wild-type and decreased affinity for NADH.
- 676:680 binding
- 688 binding
P17571 Nitrate reductase [NADH] 1; NR; EC 1.7.1.1 from Zea mays (Maize) (see 3 papers)
30% identity, 45% coverage: 63:223/360 of query aligns to 408:599/621 of P17571
- RAYT 413:416 (≠ RCYS 68:71) binding
- LVK 430:432 (≠ LPK 81:83) binding
- F435 (≠ V86) binding
- LMT 447:449 (≠ RVS 93:95) binding
- S497 (= S135) binding
- T500 (= T138) binding
- C593 (= C217) Necessary for efficient electron Transfer; mutation to S: Reduction of activity.
1cneA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
29% identity, 45% coverage: 63:223/360 of query aligns to 47:238/260 of 1cneA
- active site: Y54 (= Y70), T55 (≠ S71), S232 (≠ C217)
- binding flavin-adenine dinucleotide: R52 (= R68), A53 (≠ C69), Y54 (= Y70), L69 (= L81), V70 (≠ P82), Y73 (≠ T85), H78 (vs. gap), G84 (= G91), M87 (≠ V94), T88 (≠ S95)
Sites not aligning to the query:
7ylrA Structure of a bacteria protein
30% identity, 75% coverage: 87:356/360 of query aligns to 82:325/326 of 7ylrA
- binding fe2/s2 (inorganic) cluster: C276 (= C307), K277 (≠ E308), G279 (= G310), C281 (= C312), G282 (= G313), C284 (= C315), C314 (= C345)
- binding flavin mononucleotide: G86 (= G91), R87 (≠ G92), G89 (≠ V94), S90 (= S95), T131 (= T138), E229 (= E243), F231 (= F245), E233 (≠ S247), R278 (≠ E309)
Sites not aligning to the query:
Q9ZNT1 NADH--cytochrome b5 reductase 1; EC 1.6.2.2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 43% coverage: 83:238/360 of query aligns to 113:276/281 of Q9ZNT1
Sites not aligning to the query:
- 34:40 AKR2A-binding sequence (ABS) required for mitochondrion outer membrane targeting
- 78 L→F: In cbr1-1; decreased stability and decreased activity.
7romA Crystal structure of saccharomyces cerevisiae nadh-cytochrome b5 reductase 1 (cbr1) fragment (residues 28-284) bound to fad
26% identity, 51% coverage: 52:234/360 of query aligns to 45:238/255 of 7romA
- binding flavin-adenine dinucleotide: R61 (= R68), S62 (≠ C69), Y63 (= Y70), T64 (≠ S71), L79 (≠ T85), V80 (= V86), Y83 (≠ V89), T85 (≠ G91), G86 (= G92), N87 (≠ R93), V88 (= V94), S89 (= S95), T127 (≠ S135), A130 (≠ T138)
Query Sequence
>PfGW456L13_2523 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2523
MGTQQQNLTPAEHTTASVSLQVCAVIDETLDARSLVLDVPPALRERFRYKPGQFLSFRVP
FAGKLLTRCYSMASSPLADALPKVTVKRVDGGRVSNWMNEVQVGDWLEVLPPAGHFCLDP
QADTEKPLVLFGGGSGITPVFSILKSVLHSSRRPIKLIYANRDEASVIFKDELCQLIKAH
PDQLHVVHVLDSVQGFLTDHQVRHLLRGSAGGDYFICGPGPFMDTVERTLLAVGEAAERI
HVERFVSPPDPDELLAEEAVARAAAMDSQCEALIVELDGQQHEIACKPGDTLLQSCKAAG
LDVPSSCEEGFCGACMCVVREGEVQLARNDVLTPKELADGWTLACQSRPTGARVRLKFPD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory