Comparing PfGW456L13_2532 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2532 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q0S7Q0 Cholesterol ring-cleaving hydrolase IpdB subunit; (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA hydrolase beta subunit; COCHEA-CoA hydrolase beta subunit; EC 4.1.99.- from Rhodococcus jostii (strain RHA1) (see paper)
41% identity, 95% coverage: 2:250/262 of query aligns to 4:247/253 of Q0S7Q0
6cojB Crystal structure of rhodococcus jostii rha1 ipdab e105a cochea-coa complex (see paper)
41% identity, 94% coverage: 4:250/262 of query aligns to 1:242/248 of 6cojB
5mzyB Crystal structure of the decarboxylase aiba/aibb in complex with a possible transition state analog (see paper)
24% identity, 95% coverage: 2:250/262 of query aligns to 1:238/244 of 5mzyB
5mzzB Crystal structure of the decarboxylase aiba/aibb in complex with 3- methylglutaconate (see paper)
25% identity, 87% coverage: 22:250/262 of query aligns to 17:235/241 of 5mzzB
5mzxB Crystal structure of the decarboxylase aiba/aibb in complex with 4'- diphospho pantetheine (see paper)
25% identity, 87% coverage: 22:250/262 of query aligns to 17:235/241 of 5mzxB
>PfGW456L13_2532 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2532
MSTTDYSLAELMICAASEAWREDGEVLASGIGVIPRLAASLAMLTSNPQLLMTDSEAYMV
AEPVPLGARKGYEPKRDSWMGFSRIFDNVWGGKRHALVGPTQIDRFGQANISCIGDYAKP
KAQMLGVRGFPGNSISHANSFCVPSHNRRLFVEGEVDMVASVGYNPARLARGWSLNDIDI
RLIITDLCVLDFQGPQRQMRIRSLHPGVTAAQVQDNTGFELHVPDDCPTTAAPTAEQLQL
IQRLDPHNLRALQLKDNPPGQR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory