Comparing PfGW456L13_2538 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2538 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ubvA Structure of the 3-ketoacyl-coa thiolase fada5 from m. Tuberculosis with an partially acetylated cysteine in complex with acetyl-coa and coa (see paper)
39% identity, 100% coverage: 1:382/382 of query aligns to 1:391/391 of 4ubvA
I6XHI4 Steroid 3-ketoacyl-CoA thiolase; Acetyl-CoA acetyltransferase FadA5; Beta-ketoacyl-CoA thiolase; EC 2.3.1.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 100% coverage: 1:382/382 of query aligns to 1:391/391 of I6XHI4
4ubtA Structure of the c93s variant of the 3-ketoacyl-coa thiolase fada5 from m. Tuberculosis in complex with a steroid and coa. (see paper)
39% identity, 100% coverage: 1:382/382 of query aligns to 6:396/396 of 4ubtA
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
40% identity, 99% coverage: 3:382/382 of query aligns to 3:397/397 of 8oqlC
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
40% identity, 99% coverage: 3:382/382 of query aligns to 3:398/398 of 8oqoC
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
40% identity, 99% coverage: 3:382/382 of query aligns to 4:399/399 of 8oqmD
8opyD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-b-dnq
40% identity, 99% coverage: 3:382/382 of query aligns to 4:401/401 of 8opyD
8opxC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with trehalose (fragment-b-tre)
40% identity, 99% coverage: 3:382/382 of query aligns to 3:398/398 of 8opxC
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
40% identity, 99% coverage: 3:382/382 of query aligns to 3:399/399 of 8opuC
8pf8C Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
40% identity, 99% coverage: 3:382/382 of query aligns to 3:402/402 of 8pf8C
8oqsC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
40% identity, 99% coverage: 3:382/382 of query aligns to 3:402/402 of 8oqsC
8oqpC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
40% identity, 99% coverage: 3:382/382 of query aligns to 3:402/402 of 8oqpC
7o4tD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) (see paper)
40% identity, 99% coverage: 3:382/382 of query aligns to 4:403/403 of 7o4tD
4b3iC Crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex with coenzymea bound at the hydratase active sites (see paper)
40% identity, 99% coverage: 3:382/382 of query aligns to 3:402/402 of 4b3iC
O53871 Putative acyltransferase Rv0859; EC 2.3.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 99% coverage: 3:382/382 of query aligns to 4:403/403 of O53871
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
39% identity, 99% coverage: 3:382/382 of query aligns to 6:390/390 of 2d3tC
6pccA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a (see paper)
39% identity, 100% coverage: 1:382/382 of query aligns to 4:403/403 of 6pccA
6pcbA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex with coa (see paper)
39% identity, 100% coverage: 1:382/382 of query aligns to 4:403/403 of 6pcbA
6pcdA Crystal structure of beta-ketoadipyl-coa thiolase mutant (c90s-h356a) in complex octanoyl coenzyme a (see paper)
39% identity, 100% coverage: 1:382/382 of query aligns to 5:401/401 of 6pcdA
8gqmA Crystal structure of thiolase complexed with acetyl coenzyme a
39% identity, 95% coverage: 17:380/382 of query aligns to 17:373/377 of 8gqmA
>PfGW456L13_2538 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2538
MPEAYIVDALRTPTGRRKGGLSQIHAADLGAHVLRALVERNAIPDEDYDDVIFGCVDTIG
PLAGDIARTSWLAAGLSQSVPGTTIDRQCGSSQQAVHFAAQAVMSGTQDVVIAGGVQTMT
QIPISSAMIAAEPLGFTDPFSGSEGWVRRYGAQPPTQFRSAQMIAEKWDLSRAQLEAYSL
ESHRRALQAIEQGRFNREIVPLAGVLHDETPRQTSLEKMAELEFLFGCDRVTAAVSSQTC
DAASAMLIVSEAALKRYGLTPRARIHHLSVRAEDPIWMLTAPIPATAYALKRAGMKLEDI
DRVEINEAFASVAMAWLKETGYPHEQTNVNGGAIALGHPLGATGTRLMCTLLHELERSGG
RFGMQTMCEGGGQANVTIIERL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory