SitesBLAST
Comparing PfGW456L13_2541 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2541 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
27% identity, 99% coverage: 2:397/402 of query aligns to 5:421/425 of O59010
- S65 (≠ V55) mutation to V: Strongly decreased chloride conductance.
- R276 (= R256) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (= RSS 256:258) binding
- M311 (= M291) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ A294) binding
- V355 (= V335) binding
- D394 (= D372) binding
- M395 (≠ S373) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (≠ E375) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N379) binding
- D405 (= D383) mutation to N: Strongly decreased affinity for aspartate.
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
28% identity, 94% coverage: 12:388/402 of query aligns to 7:402/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
28% identity, 94% coverage: 12:388/402 of query aligns to 7:402/408 of 6bauA
- binding cysteine: S270 (= S258), M303 (= M291), T306 (≠ A294), A345 (≠ S333), G346 (= G334), V347 (= V335), G351 (≠ S339), D386 (= D372), C389 (≠ E375), T390 (= T376), N393 (= N379)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 94% coverage: 12:388/402 of query aligns to 6:401/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
27% identity, 96% coverage: 2:388/402 of query aligns to 5:410/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y7 (≠ L4), F46 (≠ I37), F46 (≠ I37), P75 (≠ N63), L91 (= L80), F95 (= F84), L130 (≠ V119), I133 (≠ S122), I159 (= I148), Y167 (vs. gap), K196 (≠ V174), G200 (≠ L178), I207 (≠ L185), F210 (= F188), L250 (= L233), I262 (≠ V241), M269 (≠ G249), T334 (≠ D314), V335 (= V315), G336 (≠ P316), T340 (≠ L320), L343 (≠ V323), M399 (≠ A377)
- binding aspartic acid: S277 (= S257), S278 (= S258), T314 (≠ A294), G354 (= G334), A358 (≠ G338), G359 (≠ S339), D394 (= D372), R397 (≠ E375), T398 (= T376)
- binding sodium ion: Y89 (≠ L78), T92 (≠ L81), S93 (≠ G82), G306 (= G286), T308 (= T288), N310 (= N290), N310 (= N290), M311 (= M291), D312 (≠ A292), S349 (≠ A329), I350 (≠ C330), T352 (≠ A332), N401 (= N379), V402 (≠ S380), D405 (= D383)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
27% identity, 96% coverage: 2:388/402 of query aligns to 2:407/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ L4), G66 (vs. gap), V83 (≠ I75), I157 (≠ G149), Y164 (vs. gap), K193 (≠ V174), T305 (= T288), I306 (= I289), I347 (≠ C330)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I13), M199 (≠ I180), S275 (= S258), T311 (≠ A294), G356 (≠ S339), L384 (≠ I367), D391 (= D372), R394 (≠ E375)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
30% identity, 79% coverage: 12:327/402 of query aligns to 7:341/396 of 6bmiA
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
26% identity, 99% coverage: 1:399/402 of query aligns to 2:421/427 of 5e9sA
- binding aspartic acid: R274 (= R256), S275 (= S257), S276 (= S258), T313 (≠ A294), G353 (= G334), V354 (= V335), A357 (≠ G338), G358 (≠ S339), D394 (= D372), R397 (≠ E375), T398 (= T376)
- binding decyl-beta-d-maltopyranoside: L194 (≠ V174), G198 (≠ L178), Y202 (≠ F182)
- binding sodium ion: Y87 (≠ L80), T90 (= T83), S91 (≠ F84), S276 (= S258), G305 (= G286), A306 (= A287), T307 (= T288), N309 (= N290), N309 (= N290), M310 (= M291), D311 (≠ A292), S348 (≠ A329), I349 (≠ C330), G350 (= G331), T351 (≠ A332), N401 (= N379), V402 (≠ S380), D405 (= D383)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
26% identity, 99% coverage: 1:399/402 of query aligns to 2:421/426 of 6xwnB
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
26% identity, 99% coverage: 2:399/402 of query aligns to 1:419/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
27% identity, 70% coverage: 120:399/402 of query aligns to 126:418/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ V174), G195 (≠ L178), R282 (≠ E267)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (= R256), S272 (= S257), S273 (= S258), M307 (= M291), T310 (≠ A294), G353 (= G337), A354 (≠ G338), R394 (≠ E375), T395 (= T376)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
27% identity, 97% coverage: 12:399/402 of query aligns to 6:410/416 of 6r7rA
- binding d-aspartic acid: R263 (= R256), S265 (= S258), M299 (= M291), T302 (≠ A294), T340 (≠ A332), G342 (= G334), V343 (= V335), G347 (≠ S339), D383 (= D372), R386 (≠ E375), T387 (= T376), N390 (= N379)
- binding decyl-beta-d-maltopyranoside: H23 (≠ D29), V212 (≠ L203), A216 (= A207)
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
23% identity, 90% coverage: 26:385/402 of query aligns to 45:393/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ H66), G89 (= G67), G92 (≠ H71), A95 (≠ P74), V96 (≠ I75), Y99 (= Y79), M163 (≠ I148), F167 (≠ I152), F293 (≠ V281), V297 (≠ L285)
- binding aspartic acid: S268 (= S257), S269 (= S258), T306 (≠ A294), G346 (= G334), I347 (≠ V335), A350 (≠ G338), G351 (≠ S339), D380 (= D372), R383 (≠ E375), T384 (= T376)
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
25% identity, 60% coverage: 131:371/402 of query aligns to 233:479/543 of P56564
Sites not aligning to the query:
- 206 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 216 modified: carbohydrate, N-linked (GlcNAc...) asparagine
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
24% identity, 92% coverage: 13:383/402 of query aligns to 11:388/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (= S60), L58 (≠ I61), L65 (≠ Q68), V339 (≠ C330), G340 (= G331), S343 (≠ G334), I344 (≠ V335)
- binding cholesterol: W188 (≠ S181), I227 (vs. gap), F250 (≠ L242), W257 (≠ G249), M379 (≠ A374), S382 (≠ A377)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S258), M300 (= M291), T303 (≠ A294), Y306 (≠ T297), G348 (≠ S339), L349 (= L340), M352 (≠ I343), I366 (≠ A357), L369 (≠ V360), V370 (= V361), D373 (≠ G364), D377 (= D372), R380 (≠ E375), T381 (= T376), N384 (= N379)
Sites not aligning to the query:
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
24% identity, 60% coverage: 131:371/402 of query aligns to 233:479/542 of P43003
- S363 (≠ R256) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ RSS 256:258) binding
- T396 (= T288) binding
- T402 (≠ A294) binding
- IPQAG 443:447 (≠ VAGGS 335:339) binding
- D476 (≠ G368) binding
- R477 (≠ V369) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
Sites not aligning to the query:
- 483 binding
- 523 Y→F: No effect on activity.
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
24% identity, 90% coverage: 26:385/402 of query aligns to 37:379/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ M58), S80 (≠ H66), G81 (= G67), G84 (≠ H71), Y91 (= Y79), M156 (≠ I148), F160 (≠ I152), F286 (≠ V281), V290 (≠ L285)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ L52), I148 (≠ F140), S262 (= S258), S263 (≠ A259), A292 (= A287), T293 (= T288), M296 (= M291), T299 (≠ A294), G329 (= G331), A336 (≠ G338), G337 (≠ S339), D366 (= D372), R369 (≠ E375), N373 (= N379)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
26% identity, 65% coverage: 139:399/402 of query aligns to 204:463/503 of Q10901
Sites not aligning to the query:
- 177 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 187 modified: carbohydrate, N-linked (GlcNAc...) asparagine
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
25% identity, 72% coverage: 97:385/402 of query aligns to 179:469/532 of O35874
- N201 (≠ P113) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ E118) modified: carbohydrate, N-linked (GlcNAc...) asparagine
6mpbB Cryo-em structure of the human neutral amino acid transporter asct2 (see paper)
28% identity, 61% coverage: 139:385/402 of query aligns to 188:435/446 of 6mpbB
Query Sequence
>PfGW456L13_2541 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2541
LQRLKRLSLVTQIVIGLIAGIALALIAPDMAKSTAFIGKVFVSALKAVAPILVFVLVMAS
IANHKHGQETHIRPILFLYLLGTFAAAVVAVVASMTFPSSLVLSTQDVAVTAPGGIGEVL
QSLLLSVVDNPVSALMNANFIGILAWAIGMGIAIRHAGDTTREVLGDLSNGVTVIVRLVI
SFAPLGIFGLVASTLATSGFGALIGYAHLLAVLLGCMLFVALVMNPLIVFWKLRRNPYPL
VLTCLRESGITAFFTRSSAANIPVNLELSKRLGLHEDTYSVSIPLGATINMAGAAITITV
LTLAAVHTLGITVDVPTAILLSVVAAICACGASGVAGGSLLLIPLACSLFGIPSEIAMQV
VAVGFIIGVLQDSAETALNSSTDVLFTAAACLGEEAKAERLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory