SitesBLAST
Comparing PfGW456L13_2633 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2633 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9G6 Isocitrate lyase; ICL; Isocitrase; Isocitratase; EC 4.1.3.1 from Escherichia coli (strain K12) (see 3 papers)
72% identity, 99% coverage: 4:440/441 of query aligns to 3:434/434 of P0A9G6
- SGW 91:93 (= SGW 99:101) binding
- D157 (= D165) binding
- C195 (= C203) active site, Proton acceptor; mutation to A: Large decrease in activity.; mutation to S: Large decrease in activity.
- A219 (= A227) mutation to C: Isocitrate lyase activity is reduced compared to the wild-type.
- R232 (= R240) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1igwC Crystal structure of the isocitrate lyase from the a219c mutant of escherichia coli (see paper)
71% identity, 95% coverage: 4:423/441 of query aligns to 2:416/416 of 1igwC
- active site: Y88 (= Y97), D107 (= D116), D156 (= D165), E158 (= E167), H183 (= H192), E185 (= E194), C194 (= C203), R231 (= R240), E288 (= E297), K311 (≠ Q320), S318 (= S327), S320 (= S329)
- binding pyruvic acid: S90 (= S99), G91 (= G100), W92 (= W101), D156 (= D165), R231 (= R240), T350 (= T359)
6lrtA Crystal structure of isocitrate lyase (caur_3889) from chloroflexus aurantiacus in complex with isocitrate and manganese ion
66% identity, 99% coverage: 3:440/441 of query aligns to 1:423/423 of 6lrtA
1igwA Crystal structure of the isocitrate lyase from the a219c mutant of escherichia coli (see paper)
67% identity, 95% coverage: 4:423/441 of query aligns to 2:396/396 of 1igwA
- active site: Y88 (= Y97), D107 (= D116), D156 (= D165), E158 (= E167), H183 (= H192), E185 (= E194), C194 (= C203), R227 (= R240), E284 (= E297), K307 (≠ Q320)
- binding pyruvic acid: S90 (= S99), W92 (= W101), D156 (= D165), R227 (= R240), T330 (= T359)
7cmyC Isocitrate lyase from bacillus cereus atcc 14579 in complex with magnessium ion, glyoxylate, and succinate
63% identity, 99% coverage: 5:440/441 of query aligns to 1:417/417 of 7cmyC
P9WKK7 Isocitrate lyase; ICL; Isocitrase; Isocitratase; EC 4.1.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
63% identity, 98% coverage: 12:441/441 of query aligns to 13:428/428 of P9WKK7
- SGW 91:93 (= SGW 99:101) binding
- D153 (= D165) binding
- C191 (= C203) mutation to S: Adopts a conformation almost identical to the wild-type.
- GH 192:193 (= GH 204:205) binding
- R228 (= R240) binding
- NCSPS 313:317 (= NCSPS 325:329) binding
- K334 (≠ R346) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- T347 (= T359) binding
7rb1A Isocitrate lyase-1 from mycobacterium tuberculosis covalently modified by 5-descarboxy-5-nitro-d-isocitric acid (see paper)
63% identity, 97% coverage: 12:440/441 of query aligns to 13:427/427 of 7rb1A
- binding dihydroxyacetic acid: Y89 (= Y97), S91 (= S99), W93 (= W101), D153 (= D165), R228 (= R240), T347 (= T359)
- binding (3E)-3-(hydroxyimino)propanoic acid: C191 (= C203), G192 (= G204), H193 (= H205), R228 (= R240), S315 (= S327), S317 (= S329), T347 (= T359)
- binding magnesium ion: A276 (= A288), A279 (= A291), Q308 (= Q320)
6xppA Crystal structure of itaconate modified mycobaterium tuberculosis isocitrate lyase (see paper)
63% identity, 97% coverage: 12:440/441 of query aligns to 12:426/426 of 6xppA
- active site: Y88 (= Y97), D107 (= D116), D152 (= D165), E154 (= E167), H179 (= H192), E181 (= E194), C190 (= C203), H192 (= H205), R227 (= R240), E284 (= E297), Q307 (= Q320), S314 (= S327), S316 (= S329)
- binding 2-methylidenebutanedioic acid: W92 (= W101), C190 (= C203), H192 (= H205), R227 (= R240), N312 (= N325), S314 (= S327), S316 (= S329), T346 (= T359)
- binding magnesium ion: A275 (= A288), A278 (= A291), Q307 (= Q320)
6wsiA Intact cis-2,3-epoxysuccinic acid bound to isocitrate lyase-1 from mycobacterium tuberculosis (see paper)
63% identity, 97% coverage: 12:440/441 of query aligns to 13:427/427 of 6wsiA
- active site: Y89 (= Y97), D108 (= D116), D153 (= D165), E155 (= E167), H180 (= H192), E182 (= E194), C191 (= C203), H193 (= H205), R228 (= R240), E285 (= E297), Q308 (= Q320), S315 (= S327), S317 (= S329)
- binding magnesium ion: A276 (= A288), A279 (= A291), Q308 (= Q320)
- binding (2R,3S)-oxirane-2,3-dicarboxylic acid: C191 (= C203), G192 (= G204), H193 (= H205), R228 (= R240), E285 (= E297), N313 (= N325), S315 (= S327), S317 (= S329), T347 (= T359)
6vb9A Covalent adduct of cis-2,3-epoxysuccinic acid with isocitrate lyase-1 from mycobacterium tuberculosis (see paper)
63% identity, 97% coverage: 12:440/441 of query aligns to 13:427/427 of 6vb9A
- active site: Y89 (= Y97), D108 (= D116), D153 (= D165), E155 (= E167), H180 (= H192), E182 (= E194), C191 (= C203), H193 (= H205), R228 (= R240), E285 (= E297), Q308 (= Q320), S315 (= S327), S317 (= S329)
- binding magnesium ion: A276 (= A288), A279 (= A291), Q308 (= Q320)
- binding oxalic acid: Y89 (= Y97), S91 (= S99), G92 (= G100), W93 (= W101), D153 (= D165), C191 (= C203), R228 (= R240), W283 (= W295), T347 (= T359)
5dqlA Crystal structure of 2-vinyl glyoxylate modified isocitrate lyase from mycobacterium tuberculosis (see paper)
63% identity, 97% coverage: 12:440/441 of query aligns to 13:427/427 of 5dqlA
- active site: Y89 (= Y97), D108 (= D116), D153 (= D165), E155 (= E167), H180 (= H192), E182 (= E194), C191 (= C203), H193 (= H205), R228 (= R240), E285 (= E297), Q308 (= Q320), S315 (= S327), S317 (= S329)
- binding magnesium ion: A276 (= A288), A279 (= A291), Q308 (= Q320)
- binding 4-hydroxy-2-oxobutanoic acid: W93 (= W101), D108 (= D116), C191 (= C203), H193 (= H205), S315 (= S327), S317 (= S329), T347 (= T359), L348 (= L360)
6c4aA Crystal structure of 3-nitropropionate modified isocitrate lyase from mycobacterium tuberculosis with pyruvate (see paper)
63% identity, 97% coverage: 12:440/441 of query aligns to 14:428/428 of 6c4aA
- active site: Y90 (= Y97), D109 (= D116), D154 (= D165), E156 (= E167), H181 (= H192), E183 (= E194), C192 (= C203), H194 (= H205), R229 (= R240), E286 (= E297), Q309 (= Q320), S316 (= S327), S318 (= S329)
- binding 3-nitropropanoic acid: Y357 (≠ H368), S358 (= S369), R380 (≠ Q391)
- binding magnesium ion: A277 (= A288), A280 (= A291), Q309 (= Q320)
- binding pyruvic acid: Y90 (= Y97), S92 (= S99), G93 (= G100), W94 (= W101), D154 (= D165), C192 (= C203), R229 (= R240), W284 (= W295), T348 (= T359)
1f8iA Crystal structure of isocitrate lyase:nitropropionate:glyoxylate complex from mycobacterium tuberculosis (see paper)
62% identity, 97% coverage: 12:440/441 of query aligns to 13:427/427 of 1f8iA
- active site: Y89 (= Y97), D108 (= D116), D153 (= D165), E155 (= E167), H180 (= H192), E182 (= E194), S191 (≠ C203), H193 (= H205), R228 (= R240), E285 (= E297), Q308 (= Q320), S315 (= S327), S317 (= S329)
- binding glyoxylic acid: Y89 (= Y97), S91 (= S99), W93 (= W101), D153 (= D165), T347 (= T359)
7rbxC Crystal structure of isocitrate lyase and phosphorylmutase:isocitrate lyase from brucella melitensis biovar abortus 2308 bound to itaconic acid (see paper)
62% identity, 95% coverage: 21:440/441 of query aligns to 14:423/425 of 7rbxC
5e9fD Structural insights of isocitrate lyases from magnaporthe oryzae (see paper)
33% identity, 93% coverage: 14:421/441 of query aligns to 23:452/453 of 5e9fD
- active site: Y99 (= Y97), D118 (= D116), D172 (= D165), D174 (≠ E167), H199 (= H192), E201 (= E194), R240 (= R240), E330 (= E297), Q353 (= Q320), S360 (= S327), S362 (= S329)
- binding magnesium ion: D118 (= D116), D172 (= D165)
5e9gD Structural insights of isocitrate lyases from magnaporthe oryzae (see paper)
32% identity, 93% coverage: 14:423/441 of query aligns to 24:486/486 of 5e9gD
- active site: Y100 (= Y97), D119 (= D116), D173 (= D165), D175 (≠ E167), H200 (= H192), E202 (= E194), C211 (= C203), H213 (= H205), R248 (vs. gap), E363 (= E297), Q386 (= Q320), S393 (= S327), S395 (= S329)
- binding glyoxylic acid: Y100 (= Y97), S102 (= S99), G103 (= G100), W104 (= W101), D173 (= D165), H200 (= H192), R248 (vs. gap), T424 (= T359)
- binding glycerol: C211 (= C203), G212 (= G204), H213 (= H205), R248 (vs. gap)
7ebeA Crystal structure of isocitrate lyase-1 from candida albicans (see paper)
36% identity, 60% coverage: 6:268/441 of query aligns to 16:275/544 of 7ebeA
- active site: Y99 (= Y97), D118 (= D116), D172 (= D165), D174 (≠ E167), H199 (= H192), E201 (= E194), C210 (= C203), H212 (= H205), R247 (= R240)
- binding magnesium ion: G102 (= G100), W103 (= W101), D172 (= D165)
Sites not aligning to the query:
P28240 Isocitrate lyase; ICL; Methylisocitrate lyase; MICA; Threo-D(S)-isocitrate glyoxylate-lyase; EC 4.1.3.1; EC 4.1.3.30 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
34% identity, 71% coverage: 10:323/441 of query aligns to 24:344/557 of P28240
- T53 (≠ S40) mutation to A: Abolishes short-term enzyme inactivation by glucose addition.
- K216 (= K202) mutation to R: Reduces activity by 45%; when associated with L-220.
- M220 (= M206) mutation to L: Reduces activity by 45%; when associated with R-216.
6edwB Crystal structure of mycobacterium tuberculosis icl2 in the apo form (see paper)
36% identity, 59% coverage: 6:263/441 of query aligns to 8:264/746 of 6edwB
Sites not aligning to the query:
6edzA Crystal structure of mycobacterium tuberculosis icl2 in complex with acetyl-coa, form i (see paper)
36% identity, 59% coverage: 6:263/441 of query aligns to 8:264/733 of 6edzA
Sites not aligning to the query:
- active site: 437, 460, 467, 469
- binding acetyl coenzyme *a: 643, 644, 645, 646, 652, 653, 655, 657, 658, 679, 681, 682, 684, 688, 692, 732
Query Sequence
>PfGW456L13_2633 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2633
MALTREQQIAALEKDWAENPRWKGVTRTYSAADVVRLRGSVQPEHTFAKMGAEKLWNLVT
QGAKPAFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKNPGDDGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGTPTIILAR
TDANAADLLTSDCDPYDQPFVTGERTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGSSSVTALTGSTEEEQFH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory