Comparing PfGW456L13_2689 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
36% identity, 92% coverage: 9:316/333 of query aligns to 1:299/303 of 1wogA
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
34% identity, 86% coverage: 23:308/333 of query aligns to 27:303/316 of 3nioA
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
34% identity, 86% coverage: 23:308/333 of query aligns to 30:306/319 of Q9I3S3
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
35% identity, 90% coverage: 15:315/333 of query aligns to 17:310/318 of Q9I6K2
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
35% identity, 90% coverage: 15:315/333 of query aligns to 15:308/316 of 3nipB
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
35% identity, 90% coverage: 15:315/333 of query aligns to 14:307/315 of 3niqA
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
36% identity, 82% coverage: 36:307/333 of query aligns to 23:289/301 of 1gq6B
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
36% identity, 82% coverage: 36:307/333 of query aligns to 31:297/313 of P0DJQ3
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
31% identity, 92% coverage: 10:315/333 of query aligns to 48:354/378 of 7esrA
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
32% identity, 83% coverage: 34:308/333 of query aligns to 4:264/276 of 3lhlA
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
34% identity, 79% coverage: 34:297/333 of query aligns to 22:272/294 of 7lolA
7lbaB E. Coli agmatinase (see paper)
34% identity, 79% coverage: 34:297/333 of query aligns to 39:289/310 of 7lbaB
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
33% identity, 79% coverage: 34:297/333 of query aligns to 32:282/306 of P60651
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
30% identity, 83% coverage: 34:308/333 of query aligns to 22:278/293 of 3pzlB
G7JFU5 Arginase, mitochondrial; Agmatinase ARGAH; Arginine amidohydrolase; MtARGAH; EC 3.5.3.1; EC 3.5.3.11 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
31% identity, 89% coverage: 13:308/333 of query aligns to 37:329/338 of G7JFU5
6vstD Arginase from medicago truncatula in complex with ornithine (see paper)
30% identity, 89% coverage: 13:308/333 of query aligns to 19:311/320 of 6vstD
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
31% identity, 89% coverage: 13:308/333 of query aligns to 16:308/317 of 6vstA
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
31% identity, 82% coverage: 34:307/333 of query aligns to 20:275/284 of Q57757
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
31% identity, 84% coverage: 43:323/333 of query aligns to 54:323/323 of 4dz4B
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
33% identity, 79% coverage: 34:297/333 of query aligns to 18:262/284 of 7loxA
>PfGW456L13_2689 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2689
MSNNGYESGRLNLPFVGHCTFGKSPVCTDWDALDADVAVLGVPNDMGTQWRSGARFGPRG
IREASTLFSFGHAGAYDHEDDVMYLTASDVRMVDVGDADIVHTDMATSNKNTEYAVRKIL
DAGVMPVVLGGDHSVHAPVIKAFEGRGPIHIIHFDAHLDFVDERHGVRYGHGNPLRRASE
MNHIVGMTQMGIRNVSSSNRDDYEAAHEAGSKILSVRDVRRLGVEGVLALIPQNINYYIT
IDIDGFDPSIAPGTGTPSHGGFLYYEVLEIIQALAKRSKGNIVGMDLVEVAPVYDPTGMT
SILAAQLLLNSIGFIFHERGKVRAAAESETASA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory