Comparing PfGW456L13_2701 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2701 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00053 Cytochrome c from Cannabis sativa (Hemp) (Marijuana)
46% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00053
Sites not aligning to the query:
P00069 Cytochrome c from Guizotia abyssinica (Niger) (Ramtilla)
46% identity, 78% coverage: 25:124/129 of query aligns to 8:107/111 of P00069
Sites not aligning to the query:
P00028 Cytochrome c from Entosphenus tridentatus (Pacific lamprey) (Lampetra tridentata) (see paper)
44% identity, 77% coverage: 26:124/129 of query aligns to 2:100/105 of P00028
Sites not aligning to the query:
P00054 Cytochrome c from Sesamum indicum (Oriental sesame) (Sesamum orientale) (see paper)
45% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00054
Sites not aligning to the query:
P00067 Cytochrome c from Tropaeolum majus (Common nasturtium) (Indian cress) (see paper)
46% identity, 78% coverage: 25:124/129 of query aligns to 8:107/111 of P00067
Sites not aligning to the query:
P00038 Cytochrome c from Apis mellifera (Honeybee) (see paper)
42% identity, 79% coverage: 23:124/129 of query aligns to 3:104/108 of P00038
Sites not aligning to the query:
1co6A Crystal structure of ferrocytochrome c2 from rhodopseudomonas viridis (see paper)
44% identity, 79% coverage: 27:128/129 of query aligns to 2:102/107 of 1co6A
P00070 Cytochrome c from Helianthus annuus (Common sunflower) (see paper)
45% identity, 78% coverage: 25:125/129 of query aligns to 9:109/112 of P00070
Sites not aligning to the query:
P00072 Cytochrome c from Fagopyrum esculentum (Common buckwheat) (Polygonum fagopyrum) (see paper)
44% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00072
Sites not aligning to the query:
P00061 Cytochrome c from Solanum tuberosum (Potato) (see paper)
45% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00061
Sites not aligning to the query:
P00057 Cytochrome c from Ricinus communis (Castor bean) (see paper)
46% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00057
Sites not aligning to the query:
Q0DI31 Cytochrome c from Oryza sativa subsp. japonica (Rice) (see paper)
44% identity, 77% coverage: 26:124/129 of query aligns to 10:108/112 of Q0DI31
Sites not aligning to the query:
P00051 Cytochrome c from Cucurbita maxima (Pumpkin) (Winter squash) (see paper)
45% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00051
Sites not aligning to the query:
P00052 Cytochrome c from Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) (see paper)
44% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00052
Sites not aligning to the query:
P00083 Cytochrome c2 from Blastochloris viridis (Rhodopseudomonas viridis) (see 2 papers)
44% identity, 77% coverage: 30:128/129 of query aligns to 25:122/127 of P00083
Sites not aligning to the query:
1ccrA Structure of rice ferricytochromE C at 2.0 angstroms resolution (see paper)
44% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of 1ccrA
P00004 Cytochrome c from Equus caballus (Horse) (see 2 papers)
41% identity, 77% coverage: 26:124/129 of query aligns to 2:100/105 of P00004
Sites not aligning to the query:
P00062 Cytochrome c from Sambucus nigra (European elder) (see paper)
45% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P00062
Sites not aligning to the query:
P62773 Cytochrome c from Brassica oleracea (Wild cabbage) (see paper)
45% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P62773
Sites not aligning to the query:
P62772 Cytochrome c from Brassica napus (Rape) (see paper)
45% identity, 77% coverage: 26:124/129 of query aligns to 9:107/111 of P62772
Sites not aligning to the query:
>PfGW456L13_2701 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2701
MKKLAALTLASALTAGLFSTPTLAAGDVQAGEKVYKRLCSGCHQIGESARAFFGPQLNGV
IGRHSAVTTDYVYSDAMKSANLVWDRETLIAYLEAPKKVVPGTRMIFWGLSDPEKIEDLL
AYLQTFPAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory