SitesBLAST
Comparing PfGW456L13_2738 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2738 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
40% identity, 98% coverage: 2:336/343 of query aligns to 2:334/337 of 1krhA
- active site: C306 (= C308)
- binding flavin-adenine dinucleotide: Y143 (= Y142), R155 (= R154), S156 (= S155), Y157 (= Y156), S158 (= S157), V171 (≠ L171), V172 (≠ I172), G178 (= G178), K179 (≠ V179), M180 (= M180), S181 (= S181), T219 (= T219), E332 (= E334), F334 (= F336)
- binding fe2/s2 (inorganic) cluster: M38 (≠ L38), D39 (= D39), C40 (= C40), R41 (= R41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), C82 (= C80)
Sites not aligning to the query:
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
36% identity, 70% coverage: 102:341/343 of query aligns to 6:249/250 of 1tvcA
- active site: Y63 (= Y156), S64 (= S157), L215 (= L307)
- binding dihydroflavine-adenine dinucleotide: N24 (≠ T120), F49 (≠ Y142), R61 (= R154), S62 (= S155), Y63 (= Y156), S64 (= S157), L78 (= L171), I79 (= I172), R80 (= R173), L82 (= L175), F87 (≠ M180), G128 (= G220), N155 (≠ T248), E159 (≠ D252), S186 (= S279), G187 (≠ E280), E242 (= E334), F244 (= F336), L245 (≠ I337)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
29% identity, 94% coverage: 17:340/343 of query aligns to 12:334/334 of P0DPQ8
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
29% identity, 94% coverage: 17:340/343 of query aligns to 11:333/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y142), R144 (= R154), Q145 (≠ S155), Y146 (= Y156), S147 (= S157), H161 (≠ L171), V162 (≠ I172), V165 (≠ L175), G168 (= G178), V169 (= V179), A170 (≠ M180), T171 (≠ S181), T214 (= T219), F329 (= F336), P331 (≠ E338), S333 (≠ N340)
- binding fe2/s2 (inorganic) cluster: C34 (= C40), N35 (≠ R41), G37 (= G43), C39 (= C45), G40 (= G46), C42 (= C48), C74 (= C80)
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
29% identity, 91% coverage: 25:336/343 of query aligns to 25:333/334 of 7c3bC
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
27% identity, 93% coverage: 17:336/343 of query aligns to 13:325/326 of 4wqmA
- binding flavin-adenine dinucleotide: C36 (= C40), S38 (≠ E42), W57 (≠ Y61), Y135 (= Y142), R146 (= R154), A147 (≠ S155), Y148 (= Y156), S149 (= S157), I162 (≠ L171), V163 (≠ I172), G169 (= G178), K170 (≠ V179), V171 (≠ M180), S172 (= S181), S209 (≠ T219), F325 (= F336)
- binding fe2/s2 (inorganic) cluster: Y34 (≠ L38), C36 (= C40), N37 (≠ R41), G39 (= G43), C41 (= C45), G42 (= G46), C44 (= C48), C76 (= C80)
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
27% identity, 93% coverage: 17:336/343 of query aligns to 13:325/326 of Q03304
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
27% identity, 91% coverage: 25:336/343 of query aligns to 24:320/321 of 7c3aA
- binding flavin-adenine dinucleotide: C39 (= C40), S41 (≠ E42), W60 (≠ Y61), R152 (= R154), A153 (≠ S155), Y154 (= Y156), S155 (= S157), Y169 (≠ L171), I170 (= I172), G176 (= G178), R177 (≠ V179), F178 (≠ M180), S179 (= S181), A218 (≠ T219), F320 (= F336)
- binding fe2/s2 (inorganic) cluster: Y37 (≠ L38), C39 (= C40), A40 (≠ R41), G42 (= G43), C44 (= C45), G45 (= G46), C47 (= C48), C80 (= C80)
Sites not aligning to the query:
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
27% identity, 91% coverage: 25:336/343 of query aligns to 24:305/306 of 7c3bB
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
28% identity, 55% coverage: 131:318/343 of query aligns to 35:227/243 of 2eixA
- active site: H47 (≠ Y142), Y63 (= Y156), T64 (≠ S157), C217 (= C308)
- binding flavin-adenine dinucleotide: R61 (= R154), P62 (≠ S155), Y63 (= Y156), T64 (≠ S157), I78 (≠ L171), Y82 (≠ L175), K84 (≠ D177), G85 (= G178), M87 (= M180), S88 (= S181), T126 (= T219), T129 (≠ S222), F195 (≠ W288), M221 (≠ P312), A225 (= A316)
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
26% identity, 53% coverage: 154:336/343 of query aligns to 83:278/279 of 7qu3A
- binding flavin-adenine dinucleotide: R83 (= R154), A84 (≠ S155), Y85 (= Y156), S86 (= S157), N100 (≠ L171), A104 (vs. gap), S105 (vs. gap), L112 (= L175), P113 (= P176), G115 (= G178), Q116 (≠ V179), M117 (= M180), S118 (= S181), A155 (≠ T219), F278 (= F336)
- binding 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile: R102 (= R173), G154 (= G218), G182 (= G246), F226 (≠ W288), I227 (= I289), P252 (= P310), M255 (= M313)
Sites not aligning to the query:
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
26% identity, 53% coverage: 154:336/343 of query aligns to 83:278/280 of 7qu5A
- binding flavin-adenine dinucleotide: R83 (= R154), A84 (≠ S155), Y85 (= Y156), S86 (= S157), N100 (≠ L171), A104 (vs. gap), L112 (= L175), P113 (= P176), G115 (= G178), Q116 (≠ V179), M117 (= M180), S118 (= S181), A155 (≠ T219), F278 (= F336)
- binding gamma-Valerolactone: S105 (vs. gap), P108 (vs. gap), D196 (≠ A260), W207 (≠ Y271), H208 (= H272), L209 (= L273)
Sites not aligning to the query:
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
22% identity, 53% coverage: 154:336/343 of query aligns to 86:288/289 of 2r6hC
- active site: C260 (= C308)
- binding flavin-adenine dinucleotide: R86 (= R154), A87 (≠ S155), Y88 (= Y156), S89 (= S157), N103 (≠ L171), A107 (vs. gap), T108 (vs. gap), I122 (≠ L175), K123 (≠ P176), P124 (≠ D177), G125 (= G178), I126 (≠ V179), S127 (≠ M180), S128 (= S181), F288 (= F336)
Sites not aligning to the query:
7qu0A X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
23% identity, 51% coverage: 154:327/343 of query aligns to 83:270/279 of 7qu0A
- binding ~{N}-[2,6-bis(fluoranyl)phenyl]ethanamide: S213 (= S276), F227 (≠ W288), M256 (= M313)
- binding flavin-adenine dinucleotide: R83 (= R154), A84 (≠ S155), Y85 (= Y156), S86 (= S157), A104 (≠ L175), T105 (≠ P176), P106 (≠ D177), P107 (vs. gap), A113 (vs. gap), P114 (vs. gap), P115 (vs. gap), G116 (= G178), I117 (≠ V179), M118 (= M180), S119 (= S181)
Sites not aligning to the query:
7qtyA X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
23% identity, 51% coverage: 154:327/343 of query aligns to 83:270/279 of 7qtyA
- binding 1-(furan-2-ylmethyl)-3-(2-methylphenyl)thiourea: A184 (≠ V247), R185 (≠ T248), S213 (= S276), F227 (≠ W288), H229 (≠ P290), V255 (≠ P312), M256 (= M313)
- binding flavin-adenine dinucleotide: R83 (= R154), A84 (≠ S155), Y85 (= Y156), S86 (= S157), N100 (≠ L171), A104 (≠ L175), T105 (≠ P176), P107 (vs. gap), A113 (vs. gap), P114 (vs. gap), G116 (= G178), I117 (≠ V179), M118 (= M180), S119 (= S181)
Sites not aligning to the query:
6l2uA Soluble methane monooxygenase reductase fad-binding domain from methylosinus sporium. (see paper)
43% identity, 22% coverage: 130:203/343 of query aligns to 31:103/103 of 6l2uA
- binding flavin-adenine dinucleotide: F43 (≠ Y142), R55 (= R154), S56 (= S155), Y57 (= Y156), S58 (= S157), F71 (≠ L171), F71 (≠ L171), I72 (= I172), R73 (= R173), L75 (= L175), P76 (= P176), P76 (= P176), G78 (= G178), A79 (≠ V179), F80 (≠ M180), S81 (= S181)
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
26% identity, 59% coverage: 135:336/343 of query aligns to 183:396/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R154), Q207 (≠ S155), Y208 (= Y156), S209 (= S157), S222 (≠ F170), V223 (≠ L171), K224 (≠ I172), E226 (vs. gap), P232 (= P176), G234 (= G178), Y235 (≠ V179), V236 (≠ M180), S237 (= S181), V276 (≠ T219), T279 (≠ S222), V395 (≠ K335), F396 (= F336)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
26% identity, 59% coverage: 135:336/343 of query aligns to 183:396/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R154), Q207 (≠ S155), Y208 (= Y156), S209 (= S157), S222 (≠ F170), V223 (≠ L171), K224 (≠ I172), E226 (vs. gap), P232 (= P176), G234 (= G178), Y235 (≠ V179), V236 (≠ M180), S237 (= S181), V276 (≠ T219), T279 (≠ S222), F396 (= F336)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
26% identity, 59% coverage: 135:336/343 of query aligns to 183:396/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R154), Q207 (≠ S155), Y208 (= Y156), S209 (= S157), S222 (≠ F170), V223 (≠ L171), K224 (≠ I172), E226 (vs. gap), P232 (= P176), G234 (= G178), Y235 (≠ V179), V236 (≠ M180), S237 (= S181), E394 (= E334), V395 (≠ K335)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 397, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102, 122, 125, 126
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
26% identity, 59% coverage: 135:336/343 of query aligns to 183:396/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
Query Sequence
>PfGW456L13_2738 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2738
MNHKVAFSFADGKTSFFEVKPNELLLDAALRNGVNIPLDCREGVCGTCQGRCESGRYTQD
YVDDEALSEQDLAQRKMLSCQTRVQSDASFYFDFDSSLCNAGATQLLQAVITGVEQVSAT
TAILHLDACSHPRQLDFLPGQYARLHVPGTDEWRSYSFANRPNPDNQLQFLIRLLPDGVM
SNFIREHCRPGEVLEFEAPLGSFYLRQVSKPLVLVAGGTGLSAFLGMLDTIAEQGGCGHP
IQLFYGVTQDNDLCETQRLADYRDKIANFDYHLVVSKPSEHWKGKTGWIPDHFDRQSFEA
NPFDIYLCGPPPMVEAVKTWFSDQKIERFQMYYEKFIESNSKH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory