Comparing PfGW456L13_2867 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2867 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
4v15A Crystal structure of d-threonine aldolase from alcaligenes xylosoxidans (see paper)
28% identity, 91% coverage: 15:383/405 of query aligns to 9:347/373 of 4v15A
A1B8Z1 3-hydroxy-D-aspartate aldolase; beta-hydroxyaspartate aldolase; EC 4.1.3.41 from Paracoccus denitrificans (strain Pd 1222) (see paper)
27% identity, 90% coverage: 24:388/405 of query aligns to 26:368/387 of A1B8Z1
6qkbA Crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans (see paper)
27% identity, 90% coverage: 24:388/405 of query aligns to 23:365/384 of 6qkbA
7yqaB Crystal structure of d-threonine aldolase from chlamydomonas reinhardtii (see paper)
27% identity, 75% coverage: 22:324/405 of query aligns to 18:309/398 of 7yqaB
Sites not aligning to the query:
>PfGW456L13_2867 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2867
MSSAPNTAAVEKGTAPKGASLVRDVSLPALVLHREALEHNIRWMQAFVSDSGAELAPHGK
TSMTPALFRRQLDAGAWGITLASATQTRAAYAHGVRRVLMANQLVGTPNMALIADLLADP
TFDFYCMVDHPDNVADLGAYFASRGVRLNVMIEYGVVGGRCGCRSEQQVLDLAKAIAAQP
ALALTGIEGYEGVIHGDHAVTGIRDFAASLVRLAVQLQDSGAFAIPKPIITASGSAWYDL
IAESFEAQNAAGRFLSVLRPGSYVAHDHGIYKEAQCCVLDRRSDLHEGLRPALEVWAHVQ
SLPEPGFAVIALGKRDVAYDAGLPVPLLRYKAGVVPAEGDDVSVCKVTAVMDQHAFMTVA
PGVDLRVGDIISFGTSHPCLTFDKWRVGCLVDEQLNVIETMETCF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory