Comparing PfGW456L13_2869 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2869 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
41% identity, 99% coverage: 1:308/310 of query aligns to 4:304/306 of 4ebuA
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
41% identity, 91% coverage: 1:283/310 of query aligns to 4:275/294 of 4eumA
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
35% identity, 86% coverage: 18:283/310 of query aligns to 8:264/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
35% identity, 86% coverage: 18:283/310 of query aligns to 8:264/300 of 1v1bA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
35% identity, 86% coverage: 18:283/310 of query aligns to 8:264/309 of Q53W83
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
26% identity, 85% coverage: 13:277/310 of query aligns to 6:259/319 of Q8ZKR2
Sites not aligning to the query:
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
22% identity, 93% coverage: 17:305/310 of query aligns to 7:293/313 of Q97U29
Sites not aligning to the query:
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
22% identity, 93% coverage: 17:305/310 of query aligns to 6:292/311 of 2varA
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
26% identity, 85% coverage: 13:277/310 of query aligns to 2:248/297 of 1tz6A
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
26% identity, 85% coverage: 13:277/310 of query aligns to 2:248/299 of 1tz3A
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
24% identity, 87% coverage: 13:283/310 of query aligns to 2:268/308 of 2dcnA
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
22% identity, 85% coverage: 13:277/310 of query aligns to 3:256/306 of 5eynA
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
24% identity, 89% coverage: 32:306/310 of query aligns to 34:294/312 of 3in1A
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
26% identity, 72% coverage: 60:283/310 of query aligns to 55:268/308 of 3iq0B
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
25% identity, 85% coverage: 18:279/310 of query aligns to 12:264/312 of 4wjmA
Sites not aligning to the query:
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
25% identity, 81% coverage: 33:282/310 of query aligns to 37:267/309 of P0A9J6
Sites not aligning to the query:
1gqtB Activation of ribokinase by monovalent cations (see paper)
25% identity, 81% coverage: 33:282/310 of query aligns to 36:266/307 of 1gqtB
Sites not aligning to the query:
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
25% identity, 81% coverage: 33:282/310 of query aligns to 34:264/305 of 1rk2A
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
26% identity, 72% coverage: 55:277/310 of query aligns to 44:260/322 of 3lkiB
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
27% identity, 85% coverage: 16:277/310 of query aligns to 6:237/282 of 7fcaD
>PfGW456L13_2869 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2869
MNTINTLGPNTPRIALIGECMIELQHRADGSLQQSFGGDTLNTAVYLSRELGEDGSVDYV
TALGDDSFSDAMCQSWAAENIGLAMVQRLPGRLPGLYCIQTDAAGERRFLYWRNEAAVRD
CFTTPAAAPILAALPDYDVLYFSGITLAVLGAQGREKLLETLIEARQRDARIVFDNNYRP
RLWASVEDARAAYRSVLAYVDLALLTVDDEQALFGYADGDAVFAAYEQIGTPEVVLKRGA
QACLICCDGESFEVPAQKVERVVDTTAAGDSFSAAYLASRLKGGSPSQAAEAGHRLASRV
IQVPGALIPK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory