SitesBLAST
Comparing PfGW456L13_2923 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2923 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
89% identity, 98% coverage: 2:275/279 of query aligns to 8:281/281 of 8f73E
- binding uridine-5'-diphosphate-glucose: P14 (= P8), A16 (= A10), G17 (= G11), K31 (= K25), E32 (= E26), Q108 (= Q102), G113 (= G107), L114 (= L108), A117 (= A111), L134 (= L128), D137 (= D131), E196 (= E190), K197 (= K191), I209 (= I203)
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
63% identity, 95% coverage: 1:266/279 of query aligns to 1:258/264 of 3jukD
- binding magnesium ion: T14 (= T14), R15 (= R15)
- binding uridine-5'-diphosphate-glucose: P8 (= P8), A10 (= A10), G11 (= G11), E26 (= E26), Q94 (= Q102), M97 (= M105), G99 (= G107), L100 (= L108), A103 (= A111), L120 (= L128), D123 (= D131), Y162 (= Y170), G163 (= G171), E182 (= E190), K183 (= K191), V195 (≠ I203)
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
63% identity, 95% coverage: 1:266/279 of query aligns to 1:258/265 of 3jukA
- binding uridine-5'-diphosphate-glucose: A10 (= A10), G11 (= G11), E26 (= E26), Q94 (= Q102), M97 (= M105), G99 (= G107), L100 (= L108), A103 (= A111), D123 (= D131), Y162 (= Y170), G163 (= G171), E182 (= E190), K183 (= K191), V195 (≠ I203)
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
50% identity, 95% coverage: 2:265/279 of query aligns to 5:267/290 of 5i1fA
- binding uridine-5'-diphosphate-glucose: P11 (= P8), A13 (= A10), G14 (= G11), K28 (= K25), E29 (= E26), Q106 (= Q102), A109 (≠ M105), L110 (≠ K106), G111 (= G107), L112 (= L108), A115 (= A111), D135 (= D131), Y172 (= Y170), G173 (= G171), E192 (= E190), K193 (= K191), V205 (≠ I203)
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
50% identity, 95% coverage: 2:265/279 of query aligns to 3:261/282 of 5ve7A
- binding uridine 5'-triphosphate: P9 (= P8), V10 (≠ A9), A11 (= A10), G12 (= G11), G14 (= G13), T15 (= T14), R16 (= R15), K26 (= K25), E27 (= E26), Q104 (= Q102), A107 (≠ M105), G109 (= G107), A113 (= A111)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
48% identity, 95% coverage: 2:265/279 of query aligns to 5:265/288 of 2ux8G
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
38% identity, 95% coverage: 1:265/279 of query aligns to 1:268/290 of 6knlA
- binding triphosphate: G13 (= G13), T14 (= T14), R15 (= R15), K79 (≠ T79), K81 (= K81)
- binding uridine: P8 (= P8), G11 (= G11), K25 (= K25), Q103 (= Q102), P106 (≠ M105), G108 (= G107), P130 (≠ A129), D131 (= D130)
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
38% identity, 95% coverage: 1:265/279 of query aligns to 1:268/290 of 6k8dA
- binding uridine-5'-diphosphate-glucose: P8 (= P8), A10 (= A10), G11 (= G11), Q103 (= Q102), P106 (≠ M105), G108 (= G107), L109 (= L108), A112 (= A111), L129 (= L128), D131 (= D130), E193 (= E190), V206 (≠ I203)
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
41% identity, 95% coverage: 2:265/279 of query aligns to 5:232/255 of 2ux8A
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
38% identity, 95% coverage: 1:265/279 of query aligns to 1:263/285 of 6ikzB
- binding uridine 5'-triphosphate: P8 (= P8), V9 (≠ A9), A10 (= A10), G11 (= G11), L12 (≠ Y12), G13 (= G13), T14 (= T14), R15 (= R15), K25 (= K25), Q103 (= Q102), P106 (≠ M105), G108 (= G107), D131 (= D130)
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
38% identity, 96% coverage: 5:271/279 of query aligns to 5:273/291 of 8b6dA
- binding uridine-5'-diphosphate: P8 (= P8), A10 (= A10), G11 (= G11), L12 (≠ Y12), G13 (= G13), T14 (= T14), R15 (= R15), K25 (= K25), Q102 (= Q102), A105 (≠ M105), G107 (= G107), A111 (= A111)
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
39% identity, 94% coverage: 2:264/279 of query aligns to 3:267/299 of 2pa4B
- binding uridine-5'-diphosphate-glucose: P9 (= P8), A10 (= A9), A11 (= A10), G12 (= G11), E27 (= E26), Q103 (= Q102), P106 (≠ M105), G108 (= G107), L109 (= L108), L131 (= L128), P132 (≠ A129), D134 (= D131), Y170 (= Y170), G171 (= G171), E192 (= E190), K193 (= K191), A205 (≠ I203)
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
36% identity, 96% coverage: 5:271/279 of query aligns to 5:268/286 of 8b68A
- binding uridine-5'-diphosphate-glucose: P8 (= P8), A10 (= A10), G11 (= G11), Q102 (= Q102), A105 (≠ M105), G107 (= G107), A111 (= A111), L130 (= L128), P131 (≠ A129), D133 (= D131), A203 (≠ I203), G205 (= G205)
5z09A St0452(y97n)-utp binding form (see paper)
27% identity, 96% coverage: 4:272/279 of query aligns to 2:226/401 of 5z09A
- binding uridine 5'-triphosphate: L6 (≠ P8), A7 (= A9), A8 (= A10), G9 (= G11), S10 (≠ Y12), G11 (= G13), E12 (≠ T14), R13 (= R15), Q73 (≠ R101), G79 (= G107), G98 (≠ D130), D99 (= D131)
2ggqA Complex of hypothetical glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii
27% identity, 96% coverage: 4:272/279 of query aligns to 2:226/401 of 2ggqA
- active site: R13 (= R15)
- binding thymidine-5'-triphosphate: L6 (≠ P8), A8 (= A10), G9 (= G11), S10 (≠ Y12), G11 (= G13), E12 (≠ T14), R13 (= R15), K23 (= K25), Q73 (≠ R101), G79 (= G107), A83 (= A111), R179 (≠ G225), E181 (= E227)
Sites not aligning to the query:
Q975F9 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase; EC 2.7.7.24; EC 2.7.7.9; EC 2.7.7.83; EC 2.7.7.23; EC 2.3.1.276; EC 2.3.1.157 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 3 papers)
27% identity, 96% coverage: 4:272/279 of query aligns to 2:226/401 of Q975F9
- AGSGER 8:13 (≠ AGYGTR 10:15) binding
- Q73 (≠ R101) binding
- G79 (= G107) binding
- T80 (≠ L108) mutation T->A,G,Q: Increases both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->D,H: Decrease in GlcNAc-1-P UTase activity but increase in Glc-1-P UTase activity.; mutation T->E,K,L,M,R,W,Y: Strong decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.; mutation T->F,I: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->N,S: Strong increase in GlcNAc-1-P UTase activity and decrease in Glc-1-P UTase activity.; mutation to N: Loss of GlcNAc-1-P UTase activity; when associated with V-97.
- Y97 (≠ A129) mutation Y->A,D,F,G,I,K,T,V: Increases GlcNAc-1-P UTase activity. Decreases Glc-1-P UTase activity.; mutation Y->C,E,P,R,W: Decreases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation Y->H,L,M,N,Q,S: Increases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation to V: Loss of GlcNAc-1-P UTase activity; when associated with N-80.
- E146 (= E190) mutation E->A,C,F,G,I,K,L,M,P,Q,R,V,W,Y: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->D,N: Decrease in GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->H,S,T: Decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.
Sites not aligning to the query:
- 308 H→A: Strong decrease in GalN-1-P AcTase activity and almost loss of GlcN-1-P AcTase activity.
- 311 Y→A: Strong decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 331 N→A: Strong decrease in GalN-1-P AcTase activity and decrease in GlcN-1-P AcTase activity.
- 337 K→A: Slight decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 340 K→A: Decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 391:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 38% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 16.8 times. Significantly affects the thermostability of the entire protein.
- 397:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 20% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 4.8 times. Does not affect thermostability.
1mc3A Crystal structure of rffh (see paper)
26% identity, 95% coverage: 4:268/279 of query aligns to 3:238/291 of 1mc3A
- binding magnesium ion: D109 (= D130), D224 (= D254)
- binding thymidine-5'-triphosphate: L7 (≠ P8), G9 (≠ A10), G10 (= G11), G12 (= G13), T13 (= T14), R14 (= R15), K24 (= K25), Q25 (≠ E26), Q81 (= Q102), P84 (≠ M105), L87 (= L108), D109 (= D130)
P61887 Glucose-1-phosphate thymidylyltransferase 2; G1P-TT 2; dTDP-glucose pyrophosphorylase 2; dTDP-glucose synthase 2; EC 2.7.7.24 from Escherichia coli (strain K12) (see paper)
26% identity, 95% coverage: 4:268/279 of query aligns to 2:237/293 of P61887
- D108 (= D130) binding
- D223 (= D254) binding
4b5bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
27% identity, 96% coverage: 1:268/279 of query aligns to 1:239/293 of 4b5bA
Sites not aligning to the query:
4b4gA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
27% identity, 96% coverage: 1:268/279 of query aligns to 1:239/293 of 4b4gA
Sites not aligning to the query:
Query Sequence
>PfGW456L13_2923 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2923
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLTEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNLEGDGVLTQMVKLYKQFRCSIVAIQEVDPSETNKYGVIAGEMIRD
DIYRVHSMVEKPKPEDAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQN
GCVMAYKFKGKRFDCGGAEGYIDATNFCFENFYKTGKAY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory