SitesBLAST
Comparing PfGW456L13_2961 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2961 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
35% identity, 80% coverage: 32:286/317 of query aligns to 25:280/304 of 1wwkA
- active site: S96 (≠ Y104), R230 (= R236), D254 (= D260), E259 (= E265), H278 (= H284)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ A108), G146 (= G152), F147 (≠ L153), G148 (= G154), R149 (≠ S155), I150 (= I156), Y168 (≠ W174), D169 (≠ S175), P170 (≠ E176), V201 (≠ L207), P202 (≠ V208), T207 (≠ S213), T228 (= T234), S229 (≠ A235), D254 (= D260), H278 (= H284), G280 (= G286)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
33% identity, 71% coverage: 61:286/317 of query aligns to 56:290/334 of 5aovA
- active site: L100 (≠ Y104), R241 (= R236), D265 (= D260), E270 (= E265), H288 (= H284)
- binding glyoxylic acid: Y74 (≠ G79), A75 (≠ G80), V76 (≠ M81), G77 (≠ R82), R241 (= R236), H288 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ M81), T104 (≠ A108), F158 (≠ L153), G159 (= G154), R160 (≠ S155), I161 (= I156), S180 (= S175), R181 (≠ E176), A211 (≠ H206), V212 (≠ L207), P213 (≠ V208), T218 (≠ S213), I239 (≠ T234), A240 (= A235), R241 (= R236), H288 (= H284), G290 (= G286)
Sites not aligning to the query:
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 44:282/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G154), I148 (= I156), Y166 (≠ W174), D167 (≠ S175), P168 (≠ E176), I169 (≠ N177), I170 (≠ L178), H198 (= H206), T199 (≠ L207), L208 (= L216), R228 (= R236)
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 46:284/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ Y104), A100 (= A108), R149 (≠ S155), I150 (= I156), Y168 (≠ W174), D169 (≠ S175), P170 (≠ E176), I171 (≠ N177), H200 (= H206), T201 (≠ L207), P202 (≠ V208), T207 (≠ S213), C228 (≠ T234), A229 (= A235), R230 (= R236), H277 (= H284), G279 (= G286)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 47:285/301 of 6rj5A
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 46:284/297 of 6rj3A
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 48:286/305 of 6plfA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 47:285/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (= L151), G147 (= G152), L148 (= L153), G149 (= G154), R150 (≠ S155), I151 (= I156), G152 (= G157), D170 (≠ S175), H201 (= H206), T202 (≠ L207), P203 (≠ V208)
7dkmA Phgdh covalently linked to oridonin (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 48:286/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ M81), A102 (= A108), G148 (= G152), R151 (≠ S155), I152 (= I156), Y170 (≠ W174), D171 (≠ S175), P172 (≠ E176), I173 (≠ N177), H202 (= H206), T203 (≠ L207), P204 (≠ V208), T209 (≠ S213), C230 (≠ T234), A231 (= A235), R232 (= R236), H279 (= H284), G281 (= G286)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 47:285/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 47:285/303 of 6plgA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
35% identity, 75% coverage: 55:291/317 of query aligns to 52:290/533 of O43175
- T78 (≠ M81) binding
- R135 (≠ Q137) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ SI 155:156) binding
- D175 (≠ S175) binding
- T207 (≠ L207) binding
- CAR 234:236 (≠ TAR 234:236) binding
- D260 (= D260) binding
- V261 (= V261) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVGY 284:287) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 73% coverage: 61:291/317 of query aligns to 44:276/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ S155), Y160 (≠ W174), D161 (≠ S175), P162 (≠ E176), I164 (≠ L178), L179 (≠ K193), T193 (≠ L207), P194 (≠ V208), S198 (≠ R212), L202 (= L216)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
38% identity, 73% coverage: 55:286/317 of query aligns to 46:279/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
38% identity, 73% coverage: 55:286/317 of query aligns to 47:280/525 of 3ddnB
Sites not aligning to the query:
7cvpA The crystal structure of human phgdh from biortus.
38% identity, 58% coverage: 107:291/317 of query aligns to 54:239/254 of 7cvpA
- binding nicotinamide-adenine-dinucleotide: G101 (= G152), G103 (= G154), R104 (≠ S155), I105 (= I156), Y123 (≠ W174), D124 (≠ S175), P125 (≠ E176), I126 (≠ N177), H155 (= H206), T156 (≠ L207), P157 (≠ V208), T162 (≠ S213), C183 (≠ T234), A184 (= A235), R185 (= R236), H232 (= H284), G234 (= G286)
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
34% identity, 86% coverage: 39:312/317 of query aligns to 44:330/336 of 5z20F
- active site: S108 (≠ K105), R241 (= R236), D265 (= D260), E270 (= E265), H302 (= H284)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y104), G160 (= G154), Q161 (≠ S155), I162 (= I156), Y180 (≠ W174), D181 (≠ E176), P182 (≠ N177), C212 (≠ L207), P213 (≠ V208), T218 (≠ S213), T239 (= T234), G240 (≠ A235), R241 (= R236), H302 (= H284), A304 (≠ G286)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
29% identity, 87% coverage: 36:310/317 of query aligns to 28:320/334 of 3kb6B
- active site: S97 (≠ K105), R231 (= R236), D255 (= D260), E260 (= E265), H294 (= H284)
- binding lactic acid: F49 (≠ M56), S72 (≠ G80), V73 (≠ M81), G74 (≠ R82), Y96 (= Y104), R231 (= R236), H294 (= H284)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ M81), Y96 (= Y104), V101 (≠ A108), G150 (= G154), R151 (≠ S155), I152 (= I156), D171 (≠ E176), V172 (≠ N177), P203 (≠ V208), T229 (= T234), A230 (= A235), R231 (= R236), H294 (= H284), A296 (≠ G286), Y297 (= Y287)
7va1A Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35
38% identity, 58% coverage: 107:291/317 of query aligns to 4:189/193 of 7va1A
- binding 4-[(3-ethanoylphenyl)sulfamoyl]-~{N}-[4-(3-fluorophenyl)-1,3-thiazol-2-yl]benzamide: L50 (= L151), G53 (= G154), R57 (≠ Q158), Y73 (≠ W174), D74 (≠ S175), P75 (≠ E176), I76 (≠ N177), I77 (≠ L178), T106 (≠ L207), P107 (≠ V208), L115 (= L216)
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
38% identity, 58% coverage: 107:291/317 of query aligns to 6:191/195 of 5ofwA
Sites not aligning to the query:
Query Sequence
>PfGW456L13_2961 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2961
MPVQIAVIDDWQDVARNVVDWSALDSVGEVSFLHDYPTDTSSLAERLAGFEVICVMRERT
RFDEDLLRRLPKLKLLVTGGMRNAALDLKTAAALGIQVSGTDSYKHAAPELTWALIMAAT
RNLVVEANALRAGQWQQGLGGDLHGKTLAILGLGSIGQRVAQFGQVFGMRVIAWSENLTA
ERAAQVGVTRVSKQELFEQADVLSVHLVLSERSRGLVDAQALGWMKPSALLVNTARGPIV
DEAALIKALQKQRLAGAALDVFEQEPLPAHHPFRTLDNVLATPHVGYVSQQNYRLFFLQM
IEDIQAWSAGAPIRLLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory